close

SimulationCraft 710-01

for World of Warcraft 7.1.0 Live (wow build level 22882, git build 375fc9d)

Current simulator hotfixes

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mark of the Hidden Satyr

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 In-game testing shows that the damage from this ability is roughly 10% higher than what spelldata shows.
Mark of the Hidden Satyr (effect#1) average 29.13 26.49

Table of Contents

Raid Summary

 

Raid Event List
0 adds,count=5,first=20,cooldown=30,duration=20,last=300
1 movement,first=20,cooldown=30,distance=25,last=300
2 movement,players_only=1,first=12,cooldown=16,distance=8

Actions per Minute / DPS Variance Summary

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Int Crit Haste Mastery Vers wowhead
Mortwraith - 18.83 - 10.44 9.45 8.26 12.61 wowhead
Táunks - 16.96 - 10.83 7.84 7.53 12.10 wowhead
Illistan - -0.28 - -0.44 -0.76 -0.55 -0.82 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Buuey - - 8.69 7.18 9.98 3.81 7.27 wowhead
Oinkie - 9.35 - 5.93 5.11 4.07 6.39 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Rothlandra - 11.54 - 9.43 12.33 13.02 10.12 wowhead
Sarkul - 13.13 - 10.82 12.22 11.76 11.03 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Mellarene - - 10.31 6.35 10.24 5.19 9.50 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Zipi 12.09 - - 11.09 10.78 5.78 10.67 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Faelik - - 13.28 14.42 19.99 13.14 10.77 wowhead
Raji - - 10.77 9.03 9.33 7.81 8.62 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Vait - 13.82 - 8.54 7.16 5.55 9.86 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Bowflexn - 15.39 - 10.67 13.26 16.28 11.88 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Alacastria -0.07 - - -0.14 -0.25 -0.11 -0.14 wowhead
Mortwraith

Mortwraith : 564011 dps, 235150 dps to main target

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
564010.6 564010.6 927.5 / 0.164% 172761.2 / 30.6% 42982.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.0 13.0 Fury 2.01% 62.0 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Prepared (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Fel Barrage (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • alchemy: 4
  • herbalism: 82
Scale Factors for Mortwraith Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 18.83 12.61 10.44 9.45 8.26
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.18 1.17 1.17 1.17 1.16
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Mortwraith": Agility=18.83, CritRating=10.44, HasteRating=9.45, MasteryRating=8.26, Versatility=12.61 )

Scale Factors for other metrics

Scale Factors for Mortwraith Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 18.83 12.61 10.44 9.45 8.26
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.18 1.17 1.17 1.17 1.16
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Mortwraith": Agility=18.83, CritRating=10.44, HasteRating=9.45, MasteryRating=8.26, Versatility=12.61 )
Scale Factors for Mortwraith Priority Target Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 7.26 5.40 5.25 4.14 3.27
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.17 0.17 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Agi > Vers ~= Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Mortwraith": Agility=7.26, CritRating=5.25, HasteRating=4.14, MasteryRating=3.27, Versatility=5.40 )
Scale Factors for Mortwraith Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 18.83 12.61 10.44 9.45 8.26
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Mortwraith": Agility=18.83, CritRating=10.44, HasteRating=9.45, MasteryRating=8.26, Versatility=12.61 )
Scale Factors for Mortwraith Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for MortwraithTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Mortwraith 564011
Annihilation 17031 3.0% 17.3 16.93sec 388181 401048 Direct 34.7 133432 290786 194100 38.6% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.35 34.69 0.00 0.00 0.9680 0.0000 6733599.81 6733599.81 0.00 401048.23 401048.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.32 61.44% 133431.83 101136 159144 133451.54 123464 143318 2844173 2844173 0.00
crit 13.38 38.56% 290786.48 220476 346933 290683.37 0 312434 3889426 3889426 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 8094 1.4% 131.4 3.05sec 24705 12132 Direct 131.4 20662 41321 24705 38.6% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.39 131.39 0.00 0.00 2.0364 0.0000 3245900.00 4771780.46 31.98 12131.67 12131.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.64 42.35% 20661.66 18196 22939 20662.63 19718 21460 1149575 1689984 31.98
crit 50.73 38.61% 41320.61 36393 45877 41321.16 39437 43033 2096325 3081797 31.98
miss 25.01 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4046 0.7% 131.4 3.05sec 12349 6064 Direct 131.4 10330 20659 12349 38.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.39 131.39 0.00 0.00 2.0364 0.0000 1622446.06 2385149.39 31.98 6063.95 6063.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.66 42.36% 10330.16 9098 11469 10330.88 9851 10898 574964 845251 31.98
crit 50.70 38.59% 20659.25 18196 22939 20659.89 19802 21508 1047482 1539898 31.98
miss 25.02 19.05% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Dance 47124 8.3% 18.3 15.63sec 1017166 752965 Direct 418.8 32068 64178 44456 38.6% 0.0%  

Stats details: blade_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.31 418.85 0.00 0.00 1.3509 0.0000 18620071.16 27373268.34 31.98 752964.99 752964.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.26 61.42% 32068.31 16936 73378 32071.82 28616 36047 8249956 12128217 31.98
crit 161.58 38.58% 64177.72 33873 146756 64187.94 53741 75823 10370115 15245052 31.98
 
 

Action details: blade_dance

Static Values
  • id:188499
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:188499
  • name:Blade Dance
  • school:physical
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
 
Chaos Strike 56597 10.2% 77.4 4.75sec 295282 215669 Direct 154.8 101547 221369 147737 38.5% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.45 154.80 0.00 0.00 1.3692 0.0000 22868902.45 22868902.45 0.00 215669.08 215669.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.13 61.45% 101547.36 77797 122590 101524.55 97090 105435 9659725 9659725 0.00
crit 59.67 38.55% 221368.62 169597 267245 221351.23 203903 235461 13209178 13209178 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Death Sweep 21276 3.8% 5.4 56.88sec 1562842 1545696 Direct 124.9 48531 97054 67295 38.7% 0.0%  

Stats details: death_sweep

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 124.91 0.00 0.00 1.0112 0.0000 8405493.18 12356871.17 31.98 1545695.69 1545695.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.60 61.33% 48530.74 25228 109302 48505.15 37502 59376 3717541 5465137 31.98
crit 48.30 38.67% 97053.99 53005 218605 97019.58 68827 128271 4687952 6891734 31.98
 
 

Action details: death_sweep

Static Values
  • id:210152
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:210152
  • name:Death Sweep
  • school:physical
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
 
Demon's Bite 16249 2.9% 89.0 4.45sec 73118 57021 Direct 89.0 52771 105545 73117 38.6% 0.0%  

Stats details: demons_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.96 88.96 0.00 0.00 1.2823 0.0000 6504531.33 9562277.18 31.98 57020.78 57020.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.66 61.44% 52770.95 47205 59507 52792.32 50470 55290 2884489 4240472 31.98
crit 34.30 38.56% 105544.95 94410 119015 105589.05 99751 111973 3620042 5321805 31.98
 
 

Action details: demons_bite

Static Values
  • id:162243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
Spelldata
  • id:162243
  • name:Demon's Bite
  • school:physical
  • tooltip:
  • description:Quickly attack for $sw2 Physical damage. |cFFFFFFFFGenerates $m3 to $M3 Fury.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Eye Beam 69739 (99100) 12.3% (17.5%) 11.8 32.85sec 3315815 1695698 Periodic 560.5 0 49275 49275 100.0% 0.0% 4.9%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.84 0.00 111.73 560.50 1.9555 0.1749 27618496.48 27618496.48 0.00 1695697.87 1695697.87
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 560.5 100.00% 49274.50 43566 54919 49280.76 44592 52481 27618496 27618496 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 29361 5.2% 0.0 0.00sec 0 0 Direct 57.9 144773 289730 200714 38.6% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 57.94 0.00 0.00 0.0000 0.0000 11628430.77 11628430.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.58 61.41% 144772.92 13424 169230 144471.89 103772 164032 5150544 5150544 0.00
crit 22.36 38.59% 289730.31 26849 338461 289147.61 180809 329896 6477887 6477887 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 49464 8.7% 10.1 41.49sec 1944167 1261175 Direct 159.1 88645 177319 122866 38.6% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.05 159.10 49.07 0.00 1.5416 0.1988 19548218.33 19548218.33 0.00 1261175.38 1261175.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.70 61.41% 88644.54 67122 105769 88649.24 0 105769 8660973 8660973 0.00
crit 61.40 38.59% 177319.02 134245 211538 177309.94 0 211538 10887246 10887246 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:magic
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging abilities have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 54957 9.7% 34.4 11.83sec 632955 1566757 Direct 119.2 131979 263950 182915 38.6% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.45 119.20 0.00 0.00 0.4040 0.0000 21802989.06 21802989.06 0.00 1566756.90 1566756.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.19 61.40% 131979.12 128271 161700 131952.10 128595 137850 9659973 9659973 0.00
crit 46.01 38.60% 263949.63 256542 323399 263897.61 256902 277284 12143016 12143016 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 46845 (74931) 8.3% (13.3%) 7.1 60.48sec 4192319 3275646 Periodic 448.2 29878 59760 41412 38.6% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.08 0.00 49.39 448.23 1.2799 0.4283 18562050.32 18562050.32 0.00 982476.98 3275645.87
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 275.2 61.40% 29878.48 18090 43415 29878.82 26684 33373 8223233 8223233 0.00
crit 173.0 38.60% 59760.07 36179 86830 59758.16 52588 67069 10338817 10338817 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Rage of the Illidari 28085 5.0% 7.0 60.48sec 1582694 0 Direct 31.9 349148 0 349148 0.0% 0.0%  

Stats details: rage_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 31.87 0.00 0.00 0.0000 0.0000 11128403.88 11128403.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.87 100.00% 349147.84 227929 2240220 349657.40 309368 733047 11128404 11128404 0.00
 
 

Action details: rage_of_the_illidari

Static Values
  • id:217070
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:217070
  • name:Rage of the Illidari
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1997095.04
  • base_dd_max:1997095.04
 
Metamorphosis (_impact) 1859 0.3% 2.0 241.78sec 364869 0 Direct 7.0 75715 151366 105017 38.7% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 6.99 0.00 0.00 0.0000 0.0000 734481.91 734481.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.28 61.26% 75714.79 67122 84615 75625.88 0 84615 324410 324410 0.00
crit 2.71 38.74% 151366.47 134245 169230 146209.86 0 169230 410072 410072 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 12613 2.2% 24.8 11.65sec 200746 0 Direct 24.8 144694 289247 200745 38.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.83 24.83 0.00 0.00 0.0000 0.0000 4983687.60 7326492.85 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.20 61.22% 144694.45 123216 155327 144686.13 132979 154497 2199219 3233061 31.98
crit 9.63 38.78% 289247.27 246432 310654 289215.50 252655 310654 2784468 4093432 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 42755 (95280) 7.6% (16.9%) 47.9 8.41sec 792047 618953 Direct 108.5 113028 226031 156620 38.6% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.85 108.51 0.00 0.00 1.2797 0.0000 16995151.69 24984482.82 31.98 618953.02 618953.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.65 61.42% 113027.88 96517 121670 113022.20 106537 117236 7533555 11075039 31.98
crit 41.86 38.58% 226031.08 193034 243341 226018.52 210713 235426 9461597 13909443 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 52525 9.3% 0.0 0.00sec 0 0 Periodic 352.1 59376 0 59376 0.0% 0.0% 175.7%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 352.10 352.10 0.0000 2.0000 20906436.71 20906436.71 0.00 29688.25 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 352.1 100.00% 59376.12 28955 161934 59395.61 49925 69609 20906437 20906437 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 5392 1.0% 25.5 15.89sec 84021 0 Direct 88.8 17384 34767 24091 38.6% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.46 88.81 0.00 0.00 0.0000 0.0000 2139479.90 3145238.11 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.55 61.42% 17383.80 17128 17993 17383.73 17165 17609 948215 1393966 31.98
crit 34.26 38.58% 34767.23 34256 35986 34766.44 34256 35364 1191265 1751272 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Mortwraith
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Blur 0.1 177.53sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.15 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Consume Magic 12.6 32.56sec

Stats details: consume_magic

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.62 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_magic

Static Values
  • id:183752
  • school:chromatic
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:183752
  • name:Consume Magic
  • school:chromatic
  • tooltip:
  • description:Interrupts the enemy's spellcasting and locks them from that school of magic for {$d=3 seconds}.|cFFFFFFFF{$?s178940=false}[ Generates {$218903s1=50} Fury on a successful interrupt.][ Generates ${{$218903s2=500}/10} Pain on a successful interrupt.]|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 241.78sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.01 0.00 0.00 0.00 1.2665 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade Dance 18.3 0.0 15.6sec 15.6sec 4.63% 4.63% 0.0(0.0) 18.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blade_dance
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • blade_dance_1:4.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188499
  • name:Blade Dance
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:10.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 9.51% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 0.1 0.0 169.6sec 169.6sec 0.37% 0.37% 0.0(0.0) 0.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:0.37%

Trigger Attempt Success

  • trigger_pct:14.47%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Death Sweep 5.4 0.0 56.8sec 56.8sec 1.36% 1.36% 0.0(0.0) 5.4

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_death_sweep
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • death_sweep_1:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210152
  • name:Death Sweep
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:8.00
  • default_chance:0.00%
fel_rush_movement 1.8 0.0 147.7sec 147.7sec 0.11% 0.11% 0.0(0.0) 1.8

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.11%

Trigger Attempt Success

  • trigger_pct:94.71%
Metamorphosis 12.3 0.3 33.8sec 31.0sec 20.35% 19.46% 0.3(0.3) 12.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:20.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 58.4 1.5 6.9sec 6.8sec 58.71% 64.45% 1.5(1.5) 57.8

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:58.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 26.2 26.1 15.4sec 7.6sec 2.29% 2.29% 26.1(26.1) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:2.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 244.7sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Prepared 25.5 0.0 15.9sec 15.9sec 31.56% 31.56% 252.8(252.8) 25.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_prepared
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • prepared_1:31.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203650
  • name:Prepared
  • tooltip:Generating ${$m1*2} Fury every sec.
  • description:{$@spelldesc203551=Reduces the cooldown of Vengeful Retreat by 10 sec, and generates $203650o1 Fury over {$203650d=5 seconds} if you damage at least one enemy with Vengeful Retreat.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Rage of the Illidari 7.1 441.2 60.5sec 0.8sec 5.29% 5.29% 441.2(441.2) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rage_of_the_illidari
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rage_of_the_illidari_1:5.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217060
  • name:Rage of the Illidari
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 9.98% 9.98% 2.0(2.0) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:9.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Adaptation 7.1 0.0 60.5sec 60.5sec 34.82% 34.82% 0.0(0.0) 6.8

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rapid_adaptation
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:2154.27

Stack Uptimes

  • rapid_adaptation_1:34.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:170397
  • name:Rapid Adaptation
  • tooltip:Increases Versatility by {$s1=2036}.
  • description:Increases Versatility by {$s1=2036} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
vengeful_retreat_movement 25.5 0.0 15.9sec 15.9sec 6.34% 6.34% 0.0(0.0) 25.4

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:6.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mortwraith
annihilation Fury 17.3 693.9 40.0 40.0 9704.6
blade_dance Fury 18.3 640.7 35.0 35.0 29062.2
chaos_strike Fury 77.4 3097.9 40.0 40.0 7382.1
death_sweep Fury 5.4 188.2 35.0 35.0 44651.4
eye_beam Fury 11.8 591.8 50.0 50.0 66315.9
Resource Gains Type Count Total Average Overflow
prepared Fury 252.84 977.40 (18.57%) 3.87 33.95 3.36%
fel_rush_dmg Fury 34.45 852.59 (16.20%) 24.75 8.58 1.00%
consume_magic Fury 12.62 479.89 (9.12%) 38.03 150.99 23.93%
annihilation Fury 6.69 133.74 (2.54%) 20.00 0.00 0.00%
demons_bite Fury 88.96 2223.48 (42.24%) 24.99 1.16 0.05%
chaos_strike Fury 29.82 596.31 (11.33%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 13.13 13.00
Combat End Resource Mean Min Max
Fury 50.43 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 1.8%

Procs

Count Interval
delayed_swing__out_of_range 5.1 97.7sec
delayed_swing__channeling 25.5 31.5sec
demons_bite_in_meta 18.9 15.5sec
fel_barrage 31.0 12.6sec

Statistics & Data Analysis

Fight Length
Sample Data Mortwraith Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Mortwraith Damage Per Second
Count 9999
Mean 564010.63
Minimum 456799.26
Maximum 719570.68
Spread ( max - min ) 262771.42
Range [ ( max - min ) / 2 * 100% ] 23.29%
Standard Deviation 47320.1149
5th Percentile 494907.95
95th Percentile 647045.30
( 95th Percentile - 5th Percentile ) 152137.35
Mean Distribution
Standard Deviation 473.2248
95.00% Confidence Intervall ( 563083.13 - 564938.13 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 270
0.1% Error 27040
0.1 Scale Factor Error with Delta=300 19115041
0.05 Scale Factor Error with Delta=300 76460166
0.01 Scale Factor Error with Delta=300 1911504172
Priority Target DPS
Sample Data Mortwraith Priority Target Damage Per Second
Count 9999
Mean 235150.49
Minimum 215017.89
Maximum 267682.33
Spread ( max - min ) 52664.43
Range [ ( max - min ) / 2 * 100% ] 11.20%
Standard Deviation 6952.0899
5th Percentile 224211.95
95th Percentile 247069.21
( 95th Percentile - 5th Percentile ) 22857.26
Mean Distribution
Standard Deviation 69.5244
95.00% Confidence Intervall ( 235014.23 - 235286.76 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3357
0.1 Scale Factor Error with Delta=300 412585
0.05 Scale Factor Error with Delta=300 1650343
0.01 Scale Factor Error with Delta=300 41258594
DPS(e)
Sample Data Mortwraith Damage Per Second (Effective)
Count 9999
Mean 564010.63
Minimum 456799.26
Maximum 719570.68
Spread ( max - min ) 262771.42
Range [ ( max - min ) / 2 * 100% ] 23.29%
Damage
Sample Data Mortwraith Damage
Count 9999
Mean 224048770.63
Minimum 184223039.90
Maximum 261751000.84
Spread ( max - min ) 77527960.94
Range [ ( max - min ) / 2 * 100% ] 17.30%
DTPS
Sample Data Mortwraith Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mortwraith Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mortwraith Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mortwraith Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mortwraith Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mortwraith Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MortwraithTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mortwraith Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 47.79 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 0.15 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
A 12.62 consume_magic
B 25.48 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
C 31.68 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
D 4.84 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
E 2.99 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
F 7.09 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
G 5.38 death_sweep,if=variable.blade_dance
H 18.35 blade_dance,if=variable.blade_dance
I 22.53 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
J 17.35 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
K 10.06 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
L 11.84 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
M 7.06 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
N 77.45 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
O 5.22 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
P 88.96 demons_bite
Q 5.29 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
R 1.77 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
S 7.40 use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
T 1.01 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
U 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

012456S9D6EAFJBJKPJPPJCJPQ6JPPPJPJBDEI6GCL6PIPC6GPPINHBP6NIPNANNPC6NNPPBI6HOCIL6PSC6HFIPBNNPNPNCNQ6ANPR6HILBPPNHCI6OPNPHBNPNCNNQCI6HAL6BPPISNHF6CPPINPBNNOCNNN6CIPHPBI6L6PANHPM6NCNNPBNPNPCNIO6CHIPL6BPSPHFMNC6ANNPPPBNNNCII6D6CHPL6MBPPHPNPQ6NCNNPABNNI6CHO6PCITUJSBGPFPJAGL6PQ6CJPJPBPQR6GPADJPGCI6JIPBHPNPMNNPC6NNPABNID6HCL6IP6PSNHBFIPNCDNPPQ6NPBNL6KCNPNAPN6PNBKPNCNNDPPP6NCKKNBN6PNPCKSNN6CFL6PBKANNPNNPQ6NCD6NNBPKNPCNP6NCKNPBP6NNPPL

Sample Sequence Table

time name target resources buffs
Pre flask Mortwraith 0.0/100: 0% fury
Pre food Mortwraith 0.0/100: 0% fury
Pre augmentation Mortwraith 0.0/100: 0% fury
Pre potion Fluffy_Pillow 0.0/100: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
0:00.441 fel_barrage Fluffy_Pillow 25.0/100: 25% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:01.582 auto_attack Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:01.582 throw_glaive Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:02.432 consume_magic Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:02.432 fury_of_the_illidari Fluffy_Pillow 75.0/100: 75% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:03.281 annihilation Fluffy_Pillow 75.0/100: 75% fury bloodlust, metamorphosis, momentum, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.131 vengeful_retreat Fluffy_Pillow 55.0/100: 55% fury bloodlust, metamorphosis, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.131 annihilation Fluffy_Pillow 55.0/100: 55% fury bloodlust, metamorphosis, momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:04.982 throw_glaive Fluffy_Pillow 19.0/100: 19% fury bloodlust, metamorphosis, momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:05.831 demons_bite Fluffy_Pillow 27.0/100: 27% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:06.681 annihilation Fluffy_Pillow 57.0/100: 57% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:07.529 demons_bite Fluffy_Pillow 21.0/100: 21% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:08.378 demons_bite Fluffy_Pillow 49.0/100: 49% fury bloodlust, metamorphosis, prepared, potion_of_the_old_war, rapid_adaptation
0:09.229 annihilation Fluffy_Pillow 83.0/100: 83% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:10.080 fel_rush Fluffy_Pillow 43.0/100: 43% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:10.514 annihilation Fluffy_Pillow 68.0/100: 68% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:11.366 demons_bite Fluffy_Pillow 28.0/100: 28% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:12.218 throw_glaive Fluffy_Pillow 50.0/100: 50% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.067 auto_attack Fluffy_Pillow 50.0/100: 50% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.067 annihilation Fluffy_Pillow 50.0/100: 50% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.919 demons_bite Fluffy_Pillow 10.0/100: 10% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:14.769 demons_bite Fluffy_Pillow 34.0/100: 34% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:15.620 demons_bite Fluffy_Pillow 62.0/100: 62% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:16.470 annihilation Fluffy_Pillow 88.0/100: 88% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:17.322 demons_bite Fluffy_Pillow 48.0/100: 48% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:18.170 annihilation Fluffy_Pillow 71.0/100: 71% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:19.020 vengeful_retreat Fluffy_Pillow 31.0/100: 31% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:19.131 fel_barrage Fluffy_Pillow 31.0/100: 31% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:20.309 throw_glaive Fluffy_Pillow 39.0/100: 39% fury bloodlust, raid_movement, metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war
0:21.159 throw_glaive Fluffy_Pillow 47.0/100: 47% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war
0:22.009 Waiting 1.000 sec 51.0/100: 51% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war
0:23.009 auto_attack Fluffy_Pillow 59.0/100: 59% fury bloodlust, metamorphosis, momentum, prepared
0:23.009 death_sweep Fluffy_Pillow 59.0/100: 59% fury bloodlust, metamorphosis, momentum, prepared
0:23.860 fel_rush Fluffy_Pillow 32.0/100: 32% fury bloodlust, metamorphosis, death_sweep, prepared
0:24.262 eye_beam Fluffy_Pillow 61.0/100: 61% fury bloodlust, metamorphosis, momentum
0:25.608 auto_attack Fluffy_Pillow 11.0/100: 11% fury bloodlust, metamorphosis, momentum
0:25.608 demons_bite Fluffy_Pillow 11.0/100: 11% fury bloodlust, metamorphosis, momentum
0:26.459 throw_glaive Fluffy_Pillow 33.0/100: 33% fury bloodlust, metamorphosis, momentum
0:27.311 demons_bite Fluffy_Pillow 33.0/100: 33% fury bloodlust, metamorphosis, momentum
0:28.161 fel_rush Fluffy_Pillow 57.0/100: 57% fury bloodlust, raid_movement, metamorphosis
0:28.584 Waiting 0.400 sec 82.0/100: 82% fury bloodlust, raid_movement, metamorphosis, momentum
0:28.984 auto_attack Fluffy_Pillow 82.0/100: 82% fury bloodlust, metamorphosis, momentum
0:28.984 death_sweep Fluffy_Pillow 82.0/100: 82% fury bloodlust, metamorphosis, momentum
0:29.835 demons_bite Fluffy_Pillow 47.0/100: 47% fury bloodlust, metamorphosis, death_sweep, momentum
0:30.685 demons_bite Fluffy_Pillow 67.0/100: 67% fury bloodlust, momentum
0:31.748 throw_glaive Fluffy_Pillow 95.0/100: 95% fury bloodlust, momentum
0:32.809 chaos_strike Fluffy_Pillow 95.0/100: 95% fury bloodlust
0:33.873 blade_dance Fluffy_Pillow 75.0/100: 75% fury bloodlust
0:34.936 vengeful_retreat Fluffy_Pillow 40.0/100: 40% fury bloodlust
0:34.936 demons_bite Fluffy_Pillow 40.0/100: 40% fury bloodlust, momentum, prepared, vengeful_retreat_movement
0:35.998 Waiting 0.200 sec 75.0/100: 75% fury bloodlust, momentum, out_of_range, prepared
0:36.198 auto_attack Fluffy_Pillow 75.0/100: 75% fury bloodlust, momentum, prepared
0:36.198 chaos_strike Fluffy_Pillow 75.0/100: 75% fury bloodlust, momentum, prepared
0:37.260 throw_glaive Fluffy_Pillow 63.0/100: 63% fury bloodlust, momentum, prepared
0:38.323 demons_bite Fluffy_Pillow 71.0/100: 71% fury bloodlust, momentum, prepared
0:39.386 chaos_strike Fluffy_Pillow 100.0/100: 100% fury bloodlust, prepared
0:40.447 consume_magic Fluffy_Pillow 88.0/100: 88% fury bloodlust
0:40.447 chaos_strike Fluffy_Pillow 100.0/100: 100% fury bloodlust
0:41.510 chaos_strike Fluffy_Pillow 80.0/100: 80% fury
0:42.892 demons_bite Fluffy_Pillow 40.0/100: 40% fury
0:44.274 fel_rush Fluffy_Pillow 68.0/100: 68% fury raid_movement
0:44.731 Waiting 0.300 sec 93.0/100: 93% fury raid_movement, momentum
0:45.031 auto_attack Fluffy_Pillow 93.0/100: 93% fury momentum
0:45.031 chaos_strike Fluffy_Pillow 93.0/100: 93% fury momentum
0:46.412 chaos_strike Fluffy_Pillow 53.0/100: 53% fury momentum
0:47.792 demons_bite Fluffy_Pillow 13.0/100: 13% fury momentum
0:49.173 demons_bite Fluffy_Pillow 38.0/100: 38% fury
0:50.553 vengeful_retreat Fluffy_Pillow 64.0/100: 64% fury raid_movement
0:50.553 throw_glaive Fluffy_Pillow 64.0/100: 64% fury raid_movement, momentum, prepared, vengeful_retreat_movement
0:51.934 auto_attack Fluffy_Pillow 72.0/100: 72% fury momentum, prepared
0:51.934 blade_dance Fluffy_Pillow 72.0/100: 72% fury momentum, prepared
0:53.313 fel_barrage Fluffy_Pillow 49.0/100: 49% fury momentum, prepared
0:54.886 fel_rush Fluffy_Pillow 61.0/100: 61% fury prepared
0:55.321 throw_glaive Fluffy_Pillow 90.0/100: 90% fury momentum, prepared
0:56.702 eye_beam Fluffy_Pillow 94.0/100: 94% fury momentum
0:59.013 auto_attack Fluffy_Pillow 44.0/100: 44% fury
0:59.013 demons_bite Fluffy_Pillow 44.0/100: 44% fury
1:00.394 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 72.0/100: 72% fury raid_movement
1:00.394 fel_rush Fluffy_Pillow 72.0/100: 72% fury raid_movement, rapid_adaptation
1:00.827 Waiting 0.200 sec 97.0/100: 97% fury raid_movement, momentum, rapid_adaptation
1:01.027 auto_attack Fluffy_Pillow 97.0/100: 97% fury momentum, rapid_adaptation
1:01.027 blade_dance Fluffy_Pillow 97.0/100: 97% fury momentum, rapid_adaptation
1:02.488 fury_of_the_illidari Fluffy_Pillow 62.0/100: 62% fury momentum, rapid_adaptation
1:03.869 throw_glaive Fluffy_Pillow 62.0/100: 62% fury momentum, rage_of_the_illidari, rapid_adaptation
1:05.249 demons_bite Fluffy_Pillow 62.0/100: 62% fury rage_of_the_illidari, rapid_adaptation
1:06.630 vengeful_retreat Fluffy_Pillow 90.0/100: 90% fury rapid_adaptation
1:06.630 chaos_strike Fluffy_Pillow 90.0/100: 90% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
1:08.011 chaos_strike Fluffy_Pillow 78.0/100: 78% fury momentum, prepared, rapid_adaptation
1:09.390 demons_bite Fluffy_Pillow 50.0/100: 50% fury momentum, prepared, rapid_adaptation
1:10.770 chaos_strike Fluffy_Pillow 84.0/100: 84% fury prepared, rapid_adaptation
1:12.151 demons_bite Fluffy_Pillow 52.0/100: 52% fury rapid_adaptation
1:13.531 chaos_strike Fluffy_Pillow 73.0/100: 73% fury rapid_adaptation
1:14.912 fel_rush Fluffy_Pillow 53.0/100: 53% fury rapid_adaptation
1:15.358 chaos_strike Fluffy_Pillow 78.0/100: 78% fury momentum, rapid_adaptation
1:16.737 throw_glaive Fluffy_Pillow 38.0/100: 38% fury raid_movement, momentum, rapid_adaptation
1:18.116 auto_attack Fluffy_Pillow 38.0/100: 38% fury momentum, rapid_adaptation
1:18.116 consume_magic Fluffy_Pillow 38.0/100: 38% fury momentum, rapid_adaptation
1:18.116 chaos_strike Fluffy_Pillow 88.0/100: 88% fury momentum, rapid_adaptation
1:19.496 demons_bite Fluffy_Pillow 68.0/100: 68% fury rapid_adaptation
1:20.878 fel_rush Fluffy_Pillow 93.0/100: 93% fury raid_movement
1:21.318 Waiting 0.400 sec 100.0/100: 100% fury momentum, out_of_range
1:21.718 auto_attack Fluffy_Pillow 100.0/100: 100% fury momentum
1:21.718 blade_dance Fluffy_Pillow 100.0/100: 100% fury momentum
1:23.097 throw_glaive Fluffy_Pillow 65.0/100: 65% fury momentum
1:24.481 eye_beam Fluffy_Pillow 65.0/100: 65% fury momentum
1:26.610 vengeful_retreat Fluffy_Pillow 15.0/100: 15% fury
1:26.610 demons_bite Fluffy_Pillow 15.0/100: 15% fury momentum, prepared, vengeful_retreat_movement
1:27.992 demons_bite Fluffy_Pillow 49.0/100: 49% fury momentum, prepared
1:29.373 chaos_strike Fluffy_Pillow 89.0/100: 89% fury momentum, prepared
1:30.754 blade_dance Fluffy_Pillow 61.0/100: 61% fury prepared
1:32.271 fel_rush Fluffy_Pillow 34.0/100: 34% fury raid_movement
1:32.702 throw_glaive Fluffy_Pillow 59.0/100: 59% fury raid_movement, momentum
1:34.082 auto_attack Fluffy_Pillow 59.0/100: 59% fury momentum
1:34.082 fel_barrage Fluffy_Pillow 59.0/100: 59% fury momentum
1:35.771 demons_bite Fluffy_Pillow 59.0/100: 59% fury momentum
1:37.151 chaos_strike Fluffy_Pillow 81.0/100: 81% fury
1:38.530 demons_bite Fluffy_Pillow 61.0/100: 61% fury
1:39.911 blade_dance Fluffy_Pillow 85.0/100: 85% fury
1:41.445 vengeful_retreat Fluffy_Pillow 50.0/100: 50% fury
1:41.610 chaos_strike Fluffy_Pillow 50.0/100: 50% fury momentum, prepared, vengeful_retreat_movement
1:42.990 demons_bite Fluffy_Pillow 18.0/100: 18% fury momentum, prepared
1:44.370 chaos_strike Fluffy_Pillow 56.0/100: 56% fury momentum, prepared
1:45.751 fel_rush Fluffy_Pillow 48.0/100: 48% fury prepared
1:46.137 chaos_strike Fluffy_Pillow 77.0/100: 77% fury momentum, prepared
1:47.517 chaos_strike Fluffy_Pillow 61.0/100: 61% fury momentum
1:48.898 throw_glaive Fluffy_Pillow 21.0/100: 21% fury raid_movement, momentum
1:50.279 fel_rush Fluffy_Pillow 21.0/100: 21% fury raid_movement
1:50.627 throw_glaive Fluffy_Pillow 46.0/100: 46% fury raid_movement, momentum
1:52.009 Waiting 1.000 sec 46.0/100: 46% fury raid_movement, momentum
1:53.009 auto_attack Fluffy_Pillow 46.0/100: 46% fury momentum
1:53.009 blade_dance Fluffy_Pillow 46.0/100: 46% fury momentum
1:54.390 consume_magic Fluffy_Pillow 11.0/100: 11% fury
1:54.390 eye_beam Fluffy_Pillow 61.0/100: 61% fury
1:56.487 auto_attack Fluffy_Pillow 11.0/100: 11% fury
1:56.487 vengeful_retreat Fluffy_Pillow 11.0/100: 11% fury
1:56.610 demons_bite Fluffy_Pillow 11.0/100: 11% fury momentum, prepared, vengeful_retreat_movement
1:57.990 demons_bite Fluffy_Pillow 46.0/100: 46% fury momentum, prepared
1:59.371 throw_glaive Fluffy_Pillow 83.0/100: 83% fury momentum, prepared
2:00.749 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 95.0/100: 95% fury prepared
2:00.749 chaos_strike Fluffy_Pillow 95.0/100: 95% fury prepared, rapid_adaptation
2:02.128 blade_dance Fluffy_Pillow 63.0/100: 63% fury rapid_adaptation
2:03.561 fury_of_the_illidari Fluffy_Pillow 28.0/100: 28% fury rapid_adaptation
2:04.942 auto_attack Fluffy_Pillow 28.0/100: 28% fury rage_of_the_illidari, rapid_adaptation
2:04.942 fel_rush Fluffy_Pillow 28.0/100: 28% fury rage_of_the_illidari, rapid_adaptation
2:05.409 demons_bite Fluffy_Pillow 53.0/100: 53% fury momentum, rage_of_the_illidari, rapid_adaptation
2:06.789 demons_bite Fluffy_Pillow 74.0/100: 74% fury momentum, rapid_adaptation
2:08.167 throw_glaive Fluffy_Pillow 95.0/100: 95% fury momentum, rapid_adaptation
2:09.548 chaos_strike Fluffy_Pillow 95.0/100: 95% fury rapid_adaptation
2:10.928 demons_bite Fluffy_Pillow 55.0/100: 55% fury rapid_adaptation
2:12.309 vengeful_retreat Fluffy_Pillow 78.0/100: 78% fury rapid_adaptation
2:12.309 chaos_strike Fluffy_Pillow 78.0/100: 78% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
2:13.690 chaos_strike Fluffy_Pillow 46.0/100: 46% fury momentum, prepared, rapid_adaptation
2:15.070 fel_barrage Fluffy_Pillow 38.0/100: 38% fury momentum, prepared, rapid_adaptation
2:16.706 fel_rush Fluffy_Pillow 50.0/100: 50% fury prepared, rapid_adaptation
2:17.113 chaos_strike Fluffy_Pillow 79.0/100: 79% fury momentum, prepared, rapid_adaptation
2:18.492 chaos_strike Fluffy_Pillow 63.0/100: 63% fury momentum, rapid_adaptation
2:19.874 chaos_strike Fluffy_Pillow 43.0/100: 43% fury momentum, rapid_adaptation
2:21.254 auto_attack Fluffy_Pillow 3.0/100: 3% fury
2:21.254 fel_rush Fluffy_Pillow 3.0/100: 3% fury
2:21.655 throw_glaive Fluffy_Pillow 28.0/100: 28% fury momentum
2:23.037 demons_bite Fluffy_Pillow 28.0/100: 28% fury momentum
2:24.418 blade_dance Fluffy_Pillow 58.0/100: 58% fury momentum
2:25.799 demons_bite Fluffy_Pillow 23.0/100: 23% fury
2:27.177 vengeful_retreat Fluffy_Pillow 43.0/100: 43% fury
2:27.309 throw_glaive Fluffy_Pillow 43.0/100: 43% fury momentum, prepared, vengeful_retreat_movement
2:28.691 auto_attack Fluffy_Pillow 51.0/100: 51% fury momentum, prepared
2:28.691 eye_beam Fluffy_Pillow 51.0/100: 51% fury momentum, prepared
2:30.725 auto_attack Fluffy_Pillow 17.0/100: 17% fury momentum, prepared
2:30.725 demons_bite Fluffy_Pillow 17.0/100: 17% fury momentum, prepared
2:32.105 consume_magic Fluffy_Pillow 53.0/100: 53% fury prepared
2:32.105 chaos_strike Fluffy_Pillow 100.0/100: 100% fury prepared
2:33.487 blade_dance Fluffy_Pillow 84.0/100: 84% fury
2:34.973 demons_bite Fluffy_Pillow 49.0/100: 49% fury
2:36.354 throw_glaive Fluffy_Pillow 77.0/100: 77% fury raid_movement
2:37.734 auto_attack Fluffy_Pillow 77.0/100: 77% fury
2:37.734 chaos_strike Fluffy_Pillow 77.0/100: 77% fury
2:39.116 fel_rush Fluffy_Pillow 57.0/100: 57% fury
2:39.505 chaos_strike Fluffy_Pillow 82.0/100: 82% fury momentum
2:40.885 chaos_strike Fluffy_Pillow 42.0/100: 42% fury momentum
2:42.267 demons_bite Fluffy_Pillow 22.0/100: 22% fury momentum
2:43.649 vengeful_retreat Fluffy_Pillow 43.0/100: 43% fury
2:43.649 chaos_strike Fluffy_Pillow 43.0/100: 43% fury momentum, prepared, vengeful_retreat_movement
2:45.032 demons_bite Fluffy_Pillow 11.0/100: 11% fury momentum, prepared
2:46.412 chaos_strike Fluffy_Pillow 46.0/100: 46% fury momentum, prepared
2:47.793 demons_bite Fluffy_Pillow 38.0/100: 38% fury prepared
2:49.173 fel_rush Fluffy_Pillow 69.0/100: 69% fury
2:49.573 chaos_strike Fluffy_Pillow 94.0/100: 94% fury momentum
2:50.954 throw_glaive Fluffy_Pillow 54.0/100: 54% fury raid_movement, momentum
2:52.334 fel_barrage Fluffy_Pillow 54.0/100: 54% fury raid_movement, momentum
2:53.862 auto_attack Fluffy_Pillow 54.0/100: 54% fury
2:53.862 fel_rush Fluffy_Pillow 54.0/100: 54% fury
2:54.238 blade_dance Fluffy_Pillow 79.0/100: 79% fury momentum
2:55.619 throw_glaive Fluffy_Pillow 44.0/100: 44% fury momentum
2:56.998 demons_bite Fluffy_Pillow 44.0/100: 44% fury momentum
2:58.377 eye_beam Fluffy_Pillow 71.0/100: 71% fury
3:00.473 auto_attack Fluffy_Pillow 21.0/100: 21% fury
3:00.473 vengeful_retreat Fluffy_Pillow 21.0/100: 21% fury
3:00.473 demons_bite Fluffy_Pillow 21.0/100: 21% fury momentum, prepared, vengeful_retreat_movement
3:01.852 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 55.0/100: 55% fury momentum, prepared
3:01.852 demons_bite Fluffy_Pillow 55.0/100: 55% fury momentum, prepared, rapid_adaptation
3:03.232 blade_dance Fluffy_Pillow 91.0/100: 91% fury momentum, prepared, rapid_adaptation
3:04.792 fury_of_the_illidari Fluffy_Pillow 68.0/100: 68% fury prepared, rapid_adaptation
3:06.172 throw_glaive Fluffy_Pillow 76.0/100: 76% fury rage_of_the_illidari, rapid_adaptation
3:07.553 chaos_strike Fluffy_Pillow 76.0/100: 76% fury rage_of_the_illidari, rapid_adaptation
3:08.933 fel_rush Fluffy_Pillow 56.0/100: 56% fury raid_movement, rapid_adaptation
3:09.363 auto_attack Fluffy_Pillow 81.0/100: 81% fury momentum, rapid_adaptation
3:09.363 consume_magic Fluffy_Pillow 81.0/100: 81% fury momentum, rapid_adaptation
3:09.363 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, rapid_adaptation
3:10.745 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum, rapid_adaptation
3:12.128 demons_bite Fluffy_Pillow 20.0/100: 20% fury momentum, rapid_adaptation
3:13.509 demons_bite Fluffy_Pillow 42.0/100: 42% fury rapid_adaptation
3:14.888 demons_bite Fluffy_Pillow 62.0/100: 62% fury rapid_adaptation
3:16.268 vengeful_retreat Fluffy_Pillow 87.0/100: 87% fury rapid_adaptation
3:16.268 chaos_strike Fluffy_Pillow 87.0/100: 87% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
3:17.649 chaos_strike Fluffy_Pillow 75.0/100: 75% fury momentum, prepared, rapid_adaptation
3:19.029 chaos_strike Fluffy_Pillow 47.0/100: 47% fury momentum, prepared, rapid_adaptation
3:20.410 fel_rush Fluffy_Pillow 19.0/100: 19% fury raid_movement, prepared, rapid_adaptation
3:20.782 throw_glaive Fluffy_Pillow 48.0/100: 48% fury raid_movement, momentum, prepared, rapid_adaptation
3:22.161 throw_glaive Fluffy_Pillow 52.0/100: 52% fury raid_movement, momentum
3:23.544 auto_attack Fluffy_Pillow 52.0/100: 52% fury momentum
3:23.544 fel_barrage Fluffy_Pillow 52.0/100: 52% fury momentum
3:25.113 auto_attack Fluffy_Pillow 52.0/100: 52% fury
3:25.113 fel_rush Fluffy_Pillow 52.0/100: 52% fury
3:25.490 blade_dance Fluffy_Pillow 77.0/100: 77% fury momentum
3:26.870 demons_bite Fluffy_Pillow 42.0/100: 42% fury momentum
3:28.249 eye_beam Fluffy_Pillow 65.0/100: 65% fury momentum
3:30.319 auto_attack Fluffy_Pillow 15.0/100: 15% fury
3:30.319 throw_glaive Fluffy_Pillow 15.0/100: 15% fury
3:31.785 vengeful_retreat Fluffy_Pillow 15.0/100: 15% fury
3:31.785 demons_bite Fluffy_Pillow 15.0/100: 15% fury momentum, prepared, vengeful_retreat_movement
3:33.166 demons_bite Fluffy_Pillow 50.0/100: 50% fury momentum, prepared
3:34.545 blade_dance Fluffy_Pillow 87.0/100: 87% fury momentum, prepared
3:36.043 demons_bite Fluffy_Pillow 64.0/100: 64% fury prepared
3:37.423 chaos_strike Fluffy_Pillow 100.0/100: 100% fury
3:38.802 demons_bite Fluffy_Pillow 60.0/100: 60% fury
3:40.182 throw_glaive Fluffy_Pillow 81.0/100: 81% fury raid_movement
3:41.562 auto_attack Fluffy_Pillow 81.0/100: 81% fury
3:41.562 chaos_strike Fluffy_Pillow 81.0/100: 81% fury
3:42.942 fel_rush Fluffy_Pillow 41.0/100: 41% fury
3:43.326 chaos_strike Fluffy_Pillow 66.0/100: 66% fury momentum
3:44.706 chaos_strike Fluffy_Pillow 46.0/100: 46% fury momentum
3:46.086 demons_bite Fluffy_Pillow 6.0/100: 6% fury momentum
3:47.466 consume_magic Fluffy_Pillow 30.0/100: 30% fury
3:47.466 vengeful_retreat Fluffy_Pillow 80.0/100: 80% fury
3:47.466 chaos_strike Fluffy_Pillow 80.0/100: 80% fury momentum, prepared, vengeful_retreat_movement
3:48.847 chaos_strike Fluffy_Pillow 48.0/100: 48% fury momentum, prepared
3:50.228 throw_glaive Fluffy_Pillow 20.0/100: 20% fury raid_movement, momentum, prepared
3:51.608 Waiting 1.400 sec 32.0/100: 32% fury raid_movement, prepared
3:53.008 auto_attack Fluffy_Pillow 40.0/100: 40% fury
3:53.008 fel_rush Fluffy_Pillow 40.0/100: 40% fury
3:53.426 blade_dance Fluffy_Pillow 65.0/100: 65% fury momentum
3:54.807 fel_barrage Fluffy_Pillow 30.0/100: 30% fury momentum
3:56.407 Waiting 0.600 sec 30.0/100: 30% fury raid_movement, momentum
3:57.007 auto_attack Fluffy_Pillow 30.0/100: 30% fury momentum
3:57.007 demons_bite Fluffy_Pillow 30.0/100: 30% fury momentum
3:58.388 fel_rush Fluffy_Pillow 51.0/100: 51% fury
3:58.769 throw_glaive Fluffy_Pillow 76.0/100: 76% fury momentum
4:00.150 metamorphosis Fluffy_Pillow 76.0/100: 76% fury momentum
4:01.417 potion Fluffy_Pillow 76.0/100: 76% fury metamorphosis, momentum
4:01.417 annihilation Fluffy_Pillow 76.0/100: 76% fury metamorphosis, momentum, potion_of_the_old_war
4:02.522 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 36.0/100: 36% fury metamorphosis, potion_of_the_old_war
4:02.522 vengeful_retreat Fluffy_Pillow 36.0/100: 36% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:02.522 death_sweep Fluffy_Pillow 36.0/100: 36% fury metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
4:03.704 Waiting 0.100 sec 9.0/100: 9% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:03.804 demons_bite Fluffy_Pillow 9.0/100: 9% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:04.909 fury_of_the_illidari Fluffy_Pillow 37.0/100: 37% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:06.013 demons_bite Fluffy_Pillow 45.0/100: 45% fury metamorphosis, momentum, prepared, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
4:07.116 annihilation Fluffy_Pillow 82.0/100: 82% fury metamorphosis, prepared, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
4:08.222 consume_magic Fluffy_Pillow 46.0/100: 46% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:08.222 death_sweep Fluffy_Pillow 96.0/100: 96% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:09.575 eye_beam Fluffy_Pillow 61.0/100: 61% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:11.234 auto_attack Fluffy_Pillow 11.0/100: 11% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:11.234 demons_bite Fluffy_Pillow 11.0/100: 11% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:12.337 throw_glaive Fluffy_Pillow 38.0/100: 38% fury raid_movement, metamorphosis, potion_of_the_old_war, rapid_adaptation
4:13.442 auto_attack Fluffy_Pillow 38.0/100: 38% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:13.442 fel_rush Fluffy_Pillow 38.0/100: 38% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:13.844 annihilation Fluffy_Pillow 63.0/100: 63% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:14.949 demons_bite Fluffy_Pillow 23.0/100: 23% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:16.056 annihilation Fluffy_Pillow 53.0/100: 53% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:17.162 demons_bite Fluffy_Pillow 13.0/100: 13% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:18.266 vengeful_retreat Fluffy_Pillow 38.0/100: 38% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:18.266 demons_bite Fluffy_Pillow 38.0/100: 38% fury metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
4:19.368 throw_glaive Fluffy_Pillow 75.0/100: 75% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:20.473 fel_rush Fluffy_Pillow 83.0/100: 83% fury raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:20.906 Waiting 0.500 sec 100.0/100: 100% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:21.406 auto_attack Fluffy_Pillow 100.0/100: 100% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:21.406 death_sweep Fluffy_Pillow 100.0/100: 100% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:22.511 demons_bite Fluffy_Pillow 73.0/100: 73% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:23.615 consume_magic Fluffy_Pillow 100.0/100: 100% fury metamorphosis, momentum, potion_of_the_old_war
4:23.615 fel_barrage Fluffy_Pillow 100.0/100: 100% fury metamorphosis, momentum, potion_of_the_old_war
4:24.862 annihilation Fluffy_Pillow 100.0/100: 100% fury metamorphosis, potion_of_the_old_war
4:25.967 demons_bite Fluffy_Pillow 60.0/100: 60% fury metamorphosis, potion_of_the_old_war
4:27.070 death_sweep Fluffy_Pillow 90.0/100: 90% fury metamorphosis
4:28.381 fel_rush Fluffy_Pillow 55.0/100: 55% fury raid_movement, metamorphosis
4:28.728 throw_glaive Fluffy_Pillow 80.0/100: 80% fury raid_movement, metamorphosis, momentum
4:29.833 auto_attack Fluffy_Pillow 80.0/100: 80% fury metamorphosis, momentum
4:29.833 annihilation Fluffy_Pillow 80.0/100: 80% fury metamorphosis, momentum
4:30.937 throw_glaive Fluffy_Pillow 60.0/100: 60% fury momentum
4:32.329 demons_bite Fluffy_Pillow 60.0/100: 60% fury momentum
4:33.708 vengeful_retreat Fluffy_Pillow 90.0/100: 90% fury
4:33.708 blade_dance Fluffy_Pillow 90.0/100: 90% fury momentum, prepared, vengeful_retreat_movement
4:35.089 demons_bite Fluffy_Pillow 63.0/100: 63% fury momentum, prepared
4:36.470 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
4:37.850 demons_bite Fluffy_Pillow 72.0/100: 72% fury prepared
4:39.230 throw_glaive Fluffy_Pillow 100.0/100: 100% fury
4:40.610 chaos_strike Fluffy_Pillow 100.0/100: 100% fury
4:41.991 chaos_strike Fluffy_Pillow 80.0/100: 80% fury
4:43.371 demons_bite Fluffy_Pillow 40.0/100: 40% fury
4:44.750 fel_rush Fluffy_Pillow 61.0/100: 61% fury raid_movement
4:45.110 auto_attack Fluffy_Pillow 86.0/100: 86% fury momentum
4:45.110 chaos_strike Fluffy_Pillow 86.0/100: 86% fury momentum
4:46.489 chaos_strike Fluffy_Pillow 66.0/100: 66% fury momentum
4:47.869 demons_bite Fluffy_Pillow 26.0/100: 26% fury momentum
4:49.249 consume_magic Fluffy_Pillow 48.0/100: 48% fury
4:49.249 vengeful_retreat Fluffy_Pillow 98.0/100: 98% fury
4:49.249 chaos_strike Fluffy_Pillow 98.0/100: 98% fury momentum, prepared, vengeful_retreat_movement
4:50.630 throw_glaive Fluffy_Pillow 86.0/100: 86% fury raid_movement, momentum, prepared
4:52.010 fel_barrage Fluffy_Pillow 98.0/100: 98% fury raid_movement, momentum, prepared
4:53.610 auto_attack Fluffy_Pillow 100.0/100: 100% fury prepared
4:53.610 blade_dance Fluffy_Pillow 100.0/100: 100% fury prepared
4:54.991 fel_rush Fluffy_Pillow 73.0/100: 73% fury
4:55.300 eye_beam Fluffy_Pillow 98.0/100: 98% fury momentum
4:57.480 auto_attack Fluffy_Pillow 48.0/100: 48% fury momentum
4:57.480 throw_glaive Fluffy_Pillow 48.0/100: 48% fury momentum
4:58.860 demons_bite Fluffy_Pillow 48.0/100: 48% fury momentum
5:00.241 Waiting 0.700 sec 70.0/100: 70% fury raid_movement
5:00.941 auto_attack Fluffy_Pillow 70.0/100: 70% fury
5:00.941 demons_bite Fluffy_Pillow 70.0/100: 70% fury
5:02.321 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 97.0/100: 97% fury
5:02.522 chaos_strike Fluffy_Pillow 97.0/100: 97% fury rapid_adaptation
5:03.902 blade_dance Fluffy_Pillow 57.0/100: 57% fury rapid_adaptation
5:05.284 vengeful_retreat Fluffy_Pillow 22.0/100: 22% fury rapid_adaptation
5:05.284 fury_of_the_illidari Fluffy_Pillow 22.0/100: 22% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
5:06.665 throw_glaive Fluffy_Pillow 30.0/100: 30% fury momentum, prepared, rage_of_the_illidari, rapid_adaptation
5:08.046 demons_bite Fluffy_Pillow 42.0/100: 42% fury momentum, prepared, rage_of_the_illidari, rapid_adaptation
5:09.426 chaos_strike Fluffy_Pillow 83.0/100: 83% fury prepared, rapid_adaptation
5:10.805 fel_rush Fluffy_Pillow 51.0/100: 51% fury rapid_adaptation
5:11.135 fel_barrage Fluffy_Pillow 76.0/100: 76% fury momentum, rapid_adaptation
5:12.725 chaos_strike Fluffy_Pillow 76.0/100: 76% fury momentum, rapid_adaptation
5:14.105 demons_bite Fluffy_Pillow 36.0/100: 36% fury momentum, rapid_adaptation
5:15.485 demons_bite Fluffy_Pillow 56.0/100: 56% fury rapid_adaptation
5:16.866 throw_glaive Fluffy_Pillow 84.0/100: 84% fury raid_movement, rapid_adaptation
5:18.247 auto_attack Fluffy_Pillow 84.0/100: 84% fury rapid_adaptation
5:18.247 chaos_strike Fluffy_Pillow 84.0/100: 84% fury rapid_adaptation
5:19.626 demons_bite Fluffy_Pillow 64.0/100: 64% fury rapid_adaptation
5:21.007 vengeful_retreat Fluffy_Pillow 88.0/100: 88% fury rapid_adaptation
5:21.007 chaos_strike Fluffy_Pillow 88.0/100: 88% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
5:22.387 eye_beam Fluffy_Pillow 56.0/100: 56% fury momentum, prepared, rapid_adaptation
5:24.499 auto_attack Fluffy_Pillow 22.0/100: 22% fury momentum, prepared
5:24.499 throw_glaive Fluffy_Pillow 22.0/100: 22% fury momentum, prepared
5:25.881 fel_rush Fluffy_Pillow 34.0/100: 34% fury prepared
5:26.351 chaos_strike Fluffy_Pillow 63.0/100: 63% fury momentum
5:27.731 demons_bite Fluffy_Pillow 23.0/100: 23% fury momentum
5:29.112 chaos_strike Fluffy_Pillow 52.0/100: 52% fury momentum
5:30.495 consume_magic Fluffy_Pillow 12.0/100: 12% fury
5:30.495 demons_bite Fluffy_Pillow 62.0/100: 62% fury
5:31.876 chaos_strike Fluffy_Pillow 87.0/100: 87% fury
5:33.255 auto_attack Fluffy_Pillow 47.0/100: 47% fury
5:33.255 demons_bite Fluffy_Pillow 47.0/100: 47% fury
5:34.637 chaos_strike Fluffy_Pillow 71.0/100: 71% fury
5:36.015 vengeful_retreat Fluffy_Pillow 31.0/100: 31% fury
5:36.015 throw_glaive Fluffy_Pillow 31.0/100: 31% fury momentum, prepared, vengeful_retreat_movement
5:37.396 demons_bite Fluffy_Pillow 39.0/100: 39% fury momentum, prepared
5:38.777 chaos_strike Fluffy_Pillow 72.0/100: 72% fury momentum, prepared
5:40.159 fel_rush Fluffy_Pillow 44.0/100: 44% fury prepared
5:40.574 chaos_strike Fluffy_Pillow 73.0/100: 73% fury momentum, prepared
5:41.955 chaos_strike Fluffy_Pillow 57.0/100: 57% fury momentum
5:43.335 fel_barrage Fluffy_Pillow 17.0/100: 17% fury momentum
5:44.881 demons_bite Fluffy_Pillow 17.0/100: 17% fury
5:46.262 demons_bite Fluffy_Pillow 37.0/100: 37% fury
5:47.644 demons_bite Fluffy_Pillow 63.0/100: 63% fury
5:49.024 auto_attack Fluffy_Pillow 83.0/100: 83% fury
5:49.024 chaos_strike Fluffy_Pillow 83.0/100: 83% fury
5:50.406 fel_rush Fluffy_Pillow 43.0/100: 43% fury
5:50.889 throw_glaive Fluffy_Pillow 68.0/100: 68% fury momentum
5:52.270 throw_glaive Fluffy_Pillow 68.0/100: 68% fury momentum
5:53.652 chaos_strike Fluffy_Pillow 68.0/100: 68% fury momentum
5:55.034 vengeful_retreat Fluffy_Pillow 48.0/100: 48% fury
5:55.034 chaos_strike Fluffy_Pillow 48.0/100: 48% fury momentum, prepared, vengeful_retreat_movement
5:56.415 auto_attack Fluffy_Pillow 16.0/100: 16% fury momentum, prepared
5:56.415 demons_bite Fluffy_Pillow 16.0/100: 16% fury momentum, prepared
5:57.798 chaos_strike Fluffy_Pillow 54.0/100: 54% fury momentum, prepared
5:59.177 demons_bite Fluffy_Pillow 46.0/100: 46% fury prepared
6:00.557 fel_rush Fluffy_Pillow 75.0/100: 75% fury
6:00.992 throw_glaive Fluffy_Pillow 100.0/100: 100% fury momentum
6:02.374 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 100.0/100: 100% fury momentum
6:02.522 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, rapid_adaptation
6:03.904 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum, rapid_adaptation
6:05.284 auto_attack Fluffy_Pillow 40.0/100: 40% fury rapid_adaptation
6:05.284 fel_rush Fluffy_Pillow 40.0/100: 40% fury rapid_adaptation
6:05.798 fury_of_the_illidari Fluffy_Pillow 65.0/100: 65% fury momentum, rapid_adaptation
6:07.178 eye_beam Fluffy_Pillow 65.0/100: 65% fury momentum, rage_of_the_illidari, rapid_adaptation
6:09.284 auto_attack Fluffy_Pillow 15.0/100: 15% fury rapid_adaptation
6:09.284 demons_bite Fluffy_Pillow 15.0/100: 15% fury rapid_adaptation
6:10.662 vengeful_retreat Fluffy_Pillow 37.0/100: 37% fury rapid_adaptation
6:10.662 throw_glaive Fluffy_Pillow 37.0/100: 37% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
6:12.044 consume_magic Fluffy_Pillow 45.0/100: 45% fury momentum, prepared, rapid_adaptation
6:12.044 chaos_strike Fluffy_Pillow 95.0/100: 95% fury momentum, prepared, rapid_adaptation
6:13.426 chaos_strike Fluffy_Pillow 87.0/100: 87% fury momentum, prepared, rapid_adaptation
6:14.807 demons_bite Fluffy_Pillow 59.0/100: 59% fury prepared, rapid_adaptation
6:16.189 chaos_strike Fluffy_Pillow 92.0/100: 92% fury rapid_adaptation
6:17.570 chaos_strike Fluffy_Pillow 72.0/100: 72% fury rapid_adaptation
6:18.951 demons_bite Fluffy_Pillow 52.0/100: 52% fury rapid_adaptation
6:20.332 throw_glaive Fluffy_Pillow 77.0/100: 77% fury raid_movement, rapid_adaptation
6:21.712 auto_attack Fluffy_Pillow 77.0/100: 77% fury rapid_adaptation
6:21.712 chaos_strike Fluffy_Pillow 77.0/100: 77% fury rapid_adaptation
6:23.091 fel_rush Fluffy_Pillow 57.0/100: 57% fury
6:23.448 fel_barrage Fluffy_Pillow 82.0/100: 82% fury momentum
6:24.982 auto_attack Fluffy_Pillow 82.0/100: 82% fury momentum
6:24.982 chaos_strike Fluffy_Pillow 82.0/100: 82% fury momentum
6:26.360 chaos_strike Fluffy_Pillow 42.0/100: 42% fury momentum
6:27.740 vengeful_retreat Fluffy_Pillow 2.0/100: 2% fury
6:27.740 demons_bite Fluffy_Pillow 2.0/100: 2% fury momentum, prepared, vengeful_retreat_movement
6:29.121 throw_glaive Fluffy_Pillow 38.0/100: 38% fury momentum, prepared
6:30.500 chaos_strike Fluffy_Pillow 50.0/100: 50% fury momentum, prepared
6:31.882 demons_bite Fluffy_Pillow 22.0/100: 22% fury prepared
6:33.261 fel_rush Fluffy_Pillow 52.0/100: 52% fury
6:33.692 chaos_strike Fluffy_Pillow 77.0/100: 77% fury momentum
6:35.073 demons_bite Fluffy_Pillow 37.0/100: 37% fury momentum
6:36.453 Waiting 0.500 sec 63.0/100: 63% fury raid_movement, momentum
6:36.953 auto_attack Fluffy_Pillow 63.0/100: 63% fury momentum
6:36.953 chaos_strike Fluffy_Pillow 63.0/100: 63% fury momentum
6:38.332 fel_rush Fluffy_Pillow 23.0/100: 23% fury
6:38.734 throw_glaive Fluffy_Pillow 48.0/100: 48% fury momentum
6:40.115 chaos_strike Fluffy_Pillow 48.0/100: 48% fury momentum
6:41.497 demons_bite Fluffy_Pillow 8.0/100: 8% fury momentum
6:42.878 vengeful_retreat Fluffy_Pillow 32.0/100: 32% fury
6:42.878 demons_bite Fluffy_Pillow 32.0/100: 32% fury momentum, prepared, vengeful_retreat_movement
6:44.260 auto_attack Fluffy_Pillow 68.0/100: 68% fury momentum, prepared
6:44.260 chaos_strike Fluffy_Pillow 68.0/100: 68% fury momentum, prepared
6:45.640 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum, prepared
6:47.020 demons_bite Fluffy_Pillow 32.0/100: 32% fury prepared
6:48.401 demons_bite Fluffy_Pillow 60.0/100: 60% fury
6:49.782 eye_beam Fluffy_Pillow 84.0/100: 84% fury

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25777 24071 13894 (8121)
Stamina 32604 32604 20855
Intellect 5328 5003 0
Spirit 2 2 0
Health 1956240 1956240 0
Fury 100 100 0
Crit 38.60% 37.53% 7536
Haste 9.01% 9.01% 2927
Damage / Heal Versatility 6.62% 6.62% 2646
Attack Power 25777 24071 0
Mastery 22.12% 22.12% 4943
Armor 2073 2073 2073
Run Speed 9 0 333

Gear

Source Slot Average Item Level: 858.00
Local Head Raddon's Cascading Eyes
ilevel: 895, stats: { 311 Armor, +2959 Sta, +1973 Agi, +882 Crit, +662 Haste }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +150 Crit }, enchant: { +75 Crit }
Local Shoulders Swordsinger's Shoulders
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +639 Mastery, +303 Haste }
Local Shirt Ebon Filigreed Doublet
ilevel: 1
Local Chest Dreadhide Chestguard
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +899 Crit, +359 Haste }
Local Waist Dreadhide Girdle
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +606 Crit, +429 Haste }
Local Legs Brinewashed Leather Pants
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +820 Mastery, +484 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 860, stats: { 234 Armor, +1601 Sta, +1068 AgiInt, +704 Mastery, +311 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Reluctant Partisan Gloves
ilevel: 845, stats: { 202 Armor, +929 AgiInt, +1393 Sta, +481 Mastery, +481 Crit }
Local Finger1 Ring of Deep Sea Pearls
ilevel: 870, stats: { +1319 Sta, +1244 Mastery, +735 Vers }, enchant: { +200 Crit }
Local Finger2 Dingy Suramar Mercantile Signet
ilevel: 860, stats: { +1201 Sta, +1362 Crit, +545 Vers }, enchant: { +200 Crit }
Local Trinket1 Nightborne's Hunting Horn
ilevel: 835, stats: { +1073 Agi, +882 Vers }
Local Trinket2 Vindictive Gladiator's Badge of Conquest
ilevel: 840, stats: { +1123 Agi }
Local Back Gossamer-Spun Greatcloak
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +455 Mastery, +322 Crit, +333 RunSpeed }, enchant: { +200 Agi }
Local Main Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }, relics: { +42 ilevels, +40 ilevels, +43 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Mortwraith"
origin="https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/4/157250820-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=alchemy=4/herbalism=82
talents=1133112
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1001:3:1002:3:1003:3:1005:3:1006:3:1010:1:1011:1:1012:1:1013:1:1015:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled
actions.cooldown+=/nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=raddons_cascading_eyes,id=137061,bonus_id=1811
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=150crit,enchant=75crit
shoulders=swordsingers_shoulders,id=134286,bonus_id=1727/1502/1813
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/42/1487/3337,enchant=200agi
chest=dreadhide_chestguard,id=121297,bonus_id=3473/1502/1674
shirt=ebon_filigreed_doublet,id=42360
tabard=renowned_guild_tabard,id=69210
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=reluctant_partisan_gloves,id=139940,bonus_id=3474/1507/1674
waist=dreadhide_girdle,id=121299,bonus_id=3432/1527/3337
legs=brinewashed_leather_pants,id=134238,bonus_id=3397/1512/3337
feet=manatanned_sandals,id=141430,bonus_id=1472
finger1=ring_of_deep_sea_pearls,id=141545,bonus_id=1482/3336,enchant=200crit
finger2=dingy_suramar_mercantile_signet,id=141492,bonus_id=1472,enchant=200crit
trinket1=nightbornes_hunting_horn,id=134291,bonus_id=3432/607/1497/1674
trinket2=vindictive_gladiators_badge_of_conquest,id=135804,bonus_id=3428/1472
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141255/136719/143687/0,relic_id=3474:1507:1674/1727:1492:1813/3473:1512:3336/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=857.81
# gear_agility=13894
# gear_stamina=20855
# gear_crit_rating=7536
# gear_haste_rating=2927
# gear_mastery_rating=4943
# gear_versatility_rating=2646
# gear_speed_rating=333
# gear_armor=2073

Táunks

Táunks : 487960 dps, 217145 dps to main target

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
487959.6 487959.6 760.5 / 0.156% 141852.5 / 29.1% 37331.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.0 13.0 Fury 31.40% 47.5 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Táunks/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Demon Blades (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Fel Barrage (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • skinning: 800
Scale Factors for Táunks Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 16.96 12.10 10.83 7.84 7.53
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.96 0.96 0.96 0.95 0.96
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=16.96, CritRating=10.83, HasteRating=7.84, MasteryRating=7.53, Versatility=12.10 )

Scale Factors for other metrics

Scale Factors for Táunks Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 16.96 12.10 10.83 7.84 7.53
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.96 0.96 0.96 0.95 0.96
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=16.96, CritRating=10.83, HasteRating=7.84, MasteryRating=7.53, Versatility=12.10 )
Scale Factors for Táunks Priority Target Damage Per Second
Agi Crit Vers Haste Mastery
Scale Factors 6.93 5.57 5.30 4.30 3.26
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.19 0.19 0.19 0.19 0.19
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=6.93, CritRating=5.57, HasteRating=4.30, MasteryRating=3.26, Versatility=5.30 )
Scale Factors for Táunks Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 16.96 12.10 10.83 7.84 7.53
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=16.96, CritRating=10.83, HasteRating=7.84, MasteryRating=7.53, Versatility=12.10 )
Scale Factors for Táunks Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for TáunksTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Táunks 487960
Annihilation 16590 3.4% 18.8 16.10sec 349203 373580 Direct 37.6 114994 257587 174609 41.8% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.78 37.56 0.00 0.00 0.9348 0.0000 6558574.93 6558574.93 0.00 373580.25 373580.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.86 58.19% 114994.30 92662 138798 114988.61 104163 124996 2513561 2513561 0.00
crit 15.70 41.81% 257586.55 207562 310908 257610.66 0 279991 4045014 4045014 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 8038 1.7% 140.8 2.84sec 22892 11283 Direct 140.8 18633 37267 22891 41.9% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.79 140.79 0.00 0.00 2.0289 0.0000 3222890.67 4737954.56 31.98 11282.89 11282.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.00 39.07% 18632.80 16806 20168 18632.67 17787 19495 1024829 1506595 31.98
crit 58.98 41.89% 37266.80 33613 40335 37264.39 35446 38735 2198062 3231359 31.98
miss 26.80 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4023 0.8% 140.8 2.84sec 11458 5650 Direct 140.8 9317 18632 11458 42.0% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.80 140.80 0.00 0.00 2.0282 0.0000 1613293.89 2371694.83 31.98 5649.52 5649.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.99 39.06% 9316.91 8403 10084 9316.28 8883 9707 512354 753209 31.98
crit 59.09 41.97% 18631.62 16806 20168 18630.64 17872 19470 1100940 1618486 31.98
miss 26.72 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Dance 47025 9.6% 19.2 14.90sec 966764 745778 Direct 439.8 29755 59573 42249 41.9% 0.0%  

Stats details: blade_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.22 439.81 0.00 0.00 1.2963 0.0000 18581800.66 27317007.09 31.98 745777.84 745777.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 255.53 58.10% 29755.42 15635 64483 29758.04 26282 33699 7603281 11177543 31.98
crit 184.28 41.90% 59572.85 31270 128966 59579.65 52094 68455 10978520 16139464 31.98
 
 

Action details: blade_dance

Static Values
  • id:188499
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:188499
  • name:Blade Dance
  • school:physical
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
 
Chaos Strike 53964 11.2% 80.7 4.52sec 270220 205700 Direct 161.3 88945 199255 135193 41.9% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.72 161.34 0.00 0.00 1.3137 0.0000 21811571.44 21811571.44 0.00 205699.68 205699.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.69 58.07% 88945.37 71278 106917 88905.62 85048 92253 8333605 8333605 0.00
crit 67.64 41.93% 199255.20 159663 239495 199173.54 187414 211764 13477967 13477967 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Death Sweep 17316 3.5% 4.9 64.25sec 1398301 1423634 Direct 110.4 43715 87310 61982 41.9% 0.0%  

Stats details: death_sweep

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.89 110.41 0.00 0.00 0.9823 0.0000 6843408.01 10060458.00 31.98 1423633.87 1423633.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.14 58.10% 43714.96 23290 96052 43796.33 32951 57978 2804083 4122268 31.98
crit 46.26 41.90% 87310.33 46579 192105 87459.42 62612 121873 4039325 5938190 31.98
 
 

Action details: death_sweep

Static Values
  • id:210152
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:210152
  • name:Death Sweep
  • school:physical
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
 
Demon Blades 15334 3.2% 168.8 5.86sec 36428 0 Direct 168.8 25655 51315 36428 42.0% 0.0%  

Stats details: demon_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 168.80 168.80 0.00 0.00 0.0000 0.0000 6148910.40 6148910.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.93 58.02% 25655.45 23315 27978 25656.10 24524 26745 2512427 2512427 0.00
crit 70.87 41.98% 51314.67 46630 55956 51316.99 48365 53957 3636483 3636483 0.00
 
 

Action details: demon_blades

Static Values
  • id:203796
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203796
  • name:Demon Blades
  • school:shadow
  • tooltip:
  • description:Inflicts $sw1 Shadow damage and generates $m3 to $M3 Fury.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Eye Beam 36491 (51370) 7.5% (10.5%) 7.4 54.07sec 2740762 1475510 Periodic 321.3 0 45042 45042 100.0% 0.0% 2.9%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.43 0.00 71.66 321.29 1.8575 0.1638 14471400.05 14471400.05 0.00 1475510.23 1475510.23
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 321.3 100.00% 45041.60 40247 48296 45037.13 40403 48296 14471400 14471400 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 14879 3.0% 0.0 0.00sec 0 0 Direct 31.5 132325 264554 187671 41.9% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.45 0.00 0.00 0.0000 0.0000 5902445.18 5902445.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.29 58.14% 132325.05 12402 148823 132319.53 70773 148823 2419784 2419784 0.00
crit 13.16 41.86% 264554.13 24804 297645 264661.18 119960 297645 3482661 3482661 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 41006 8.3% 9.4 44.88sec 1728547 1158222 Direct 145.1 78657 157268 111611 41.9% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.37 145.06 45.33 0.00 1.4925 0.1983 16189633.34 16189633.34 0.00 1158222.45 1158222.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.25 58.08% 78657.10 62009 93014 78700.52 0 93014 6626654 6626654 0.00
crit 60.81 41.92% 157268.48 124019 186028 157363.10 0 186028 9562980 9562980 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:magic
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging abilities have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 68752 14.1% 42.5 9.51sec 641566 1588277 Direct 161.1 119296 238591 169299 41.9% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.51 161.10 0.00 0.00 0.4040 0.0000 27273899.94 27273899.94 0.00 1588277.43 1588277.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.57 58.08% 119295.75 118500 142200 119297.29 118500 123300 11162858 11162858 0.00
crit 67.53 41.92% 238590.86 237000 284400 238590.39 237000 247938 16111042 16111042 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 42447 8.7% 7.1 60.40sec 2371280 1916127 Periodic 448.2 26450 52883 37519 41.9% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.09 0.00 49.48 448.25 1.2376 0.4283 16817850.53 16817850.53 0.00 561156.17 1916127.44
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 260.5 58.12% 26449.71 15777 37865 26451.54 24386 28861 6891196 6891196 0.00
crit 187.7 41.88% 52883.17 31554 75730 52884.22 48006 58744 9926654 9926654 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Inner Demons 14835 3.0% 7.0 52.01sec 839936 0 Direct 18.3 227025 453830 322122 41.9% 0.0%  

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.02 18.31 0.00 0.00 0.0000 0.0000 5899460.37 5899460.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.64 58.07% 227024.86 201531 241837 226379.27 0 241837 2414400 2414400 0.00
crit 7.68 41.93% 453829.82 403061 483673 450995.60 0 483673 3485061 3485061 0.00
 
 

Action details: inner_demons

Static Values
  • id:202388
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202388
  • name:Inner Demons
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201471=Chaos Strike has a chance to unleash your inner demon, causing it to crash into your target and deal {$202388s1=0} Chaos damage to all nearby enemies.}
 
Metamorphosis (_impact) 1612 0.3% 2.0 242.35sec 317959 0 Direct 6.6 68193 136318 96754 41.9% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 6.59 0.00 0.00 0.0000 0.0000 637222.57 637222.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.83 58.08% 68193.47 62009 74411 66963.45 0 74411 260845 260845 0.00
crit 2.76 41.92% 136318.27 124019 148823 129118.80 0 148823 376378 376378 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 11070 2.3% 23.3 12.64sec 187840 0 Direct 23.3 132289 264711 187841 42.0% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.28 23.28 0.00 0.00 0.0000 0.0000 4373097.79 6428867.98 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.51 58.05% 132288.84 117301 140762 132277.46 120653 140762 1787825 2628272 31.98
crit 9.77 41.95% 264711.43 234603 281523 264665.15 234603 281523 2585273 3800596 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 41033 (91418) 8.4% (18.7%) 50.0 8.04sec 726889 593845 Direct 113.7 101161 202326 143489 41.8% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.03 113.67 0.00 0.00 1.2241 0.0000 16310364.49 23977780.76 31.98 593844.81 593844.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.11 58.16% 101160.63 89101 106921 101152.23 96475 105958 6688097 9832137 31.98
crit 47.56 41.84% 202325.67 178202 213842 202311.61 191072 211356 9622267 14145644 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 50385 10.3% 0.0 0.00sec 0 0 Periodic 360.1 55688 0 55688 0.0% 0.0% 179.7%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 360.12 360.12 0.0000 2.0000 20054316.45 20054316.45 0.00 27843.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 360.1 100.00% 55687.73 26730 141670 55700.98 47961 64697 20054316 20054316 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 3160 0.6% 15.9 25.82sec 78951 0 Direct 55.8 15812 31624 22447 42.0% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.87 55.83 0.00 0.00 0.0000 0.0000 1253326.35 1842508.46 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.40 58.03% 15812.05 15812 15812 15812.05 15812 15812 512350 753204 31.98
crit 23.43 41.97% 31624.09 31624 31624 31624.09 31624 31624 740976 1089305 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Táunks
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Blur 3.5 106.03sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Consume Magic 13.3 30.86sec

Stats details: consume_magic

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.27 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_magic

Static Values
  • id:183752
  • school:chromatic
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:183752
  • name:Consume Magic
  • school:chromatic
  • tooltip:
  • description:Interrupts the enemy's spellcasting and locks them from that school of magic for {$d=3 seconds}.|cFFFFFFFF{$?s178940=false}[ Generates {$218903s1=50} Fury on a successful interrupt.][ Generates ${{$218903s2=500}/10} Pain on a successful interrupt.]|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 242.35sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.1617 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade Dance 19.2 0.0 14.9sec 14.9sec 4.86% 4.86% 0.0(0.0) 19.2

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blade_dance
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • blade_dance_1:4.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188499
  • name:Blade Dance
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:10.00
  • default_chance:0.00%
Blood Frenzy 14.3 8.6 28.3sec 17.3sec 45.59% 45.59% 8.6(8.6) 13.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 12.63% 0.0(0.0) 1.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 3.5 0.0 106.1sec 106.1sec 8.43% 8.43% 0.0(0.0) 3.3

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:8.43%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Death Sweep 4.9 0.0 64.0sec 64.0sec 1.24% 1.24% 0.0(0.0) 4.9

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_death_sweep
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • death_sweep_1:1.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210152
  • name:Death Sweep
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:8.00
  • default_chance:0.00%
fel_rush_movement 1.6 0.0 122.4sec 122.4sec 0.10% 0.10% 0.0(0.0) 1.6

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.10%

Trigger Attempt Success

  • trigger_pct:91.34%
Metamorphosis 8.1 0.3 53.4sec 49.2sec 18.23% 19.43% 0.3(0.3) 8.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:18.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 57.5 0.9 7.0sec 7.0sec 57.50% 62.62% 0.9(0.9) 56.9

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:57.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 16.5 16.5 24.6sec 11.9sec 1.47% 1.47% 16.5(16.5) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:1.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 247.3sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 10.55% 10.55% 2.0(2.0) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:10.55%

Trigger Attempt Success

  • trigger_pct:100.00%
vengeful_retreat_movement 15.9 0.0 25.8sec 25.8sec 3.96% 3.96% 0.0(0.0) 15.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:3.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Táunks
annihilation Fury 18.8 751.3 40.0 40.0 8730.1
blade_dance Fury 19.2 672.7 35.0 35.0 27621.9
chaos_strike Fury 80.7 3228.7 40.0 40.0 6755.5
death_sweep Fury 4.9 171.3 35.0 35.0 39951.9
eye_beam Fury 7.4 371.7 50.0 50.0 54815.0
Resource Gains Type Count Total Average Overflow
demon_blades Fury 168.80 2682.52 (51.31%) 15.89 17.38 0.64%
fel_rush_dmg Fury 42.51 1062.55 (20.33%) 24.99 0.24 0.02%
consume_magic Fury 13.27 649.74 (12.43%) 48.96 13.81 2.08%
annihilation Fury 7.85 157.03 (3.00%) 20.00 0.00 0.00%
chaos_strike Fury 33.80 675.93 (12.93%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 13.04 12.96
Combat End Resource Mean Min Max
Fury 32.12 0.00 120.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 0.2%

Procs

Count Interval
delayed_swing__out_of_range 4.0 106.8sec
delayed_swing__channeling 14.0 57.8sec
demon_blades_wasted 0.4 16.0sec
fel_barrage 25.9 15.0sec

Statistics & Data Analysis

Fight Length
Sample Data Táunks Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Táunks Damage Per Second
Count 9999
Mean 487959.63
Minimum 397252.51
Maximum 633124.36
Spread ( max - min ) 235871.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
Standard Deviation 38799.8619
5th Percentile 431851.09
95th Percentile 556420.10
( 95th Percentile - 5th Percentile ) 124569.01
Mean Distribution
Standard Deviation 388.0180
95.00% Confidence Intervall ( 487199.13 - 488720.13 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 242
0.1% Error 24287
0.1 Scale Factor Error with Delta=300 12851210
0.05 Scale Factor Error with Delta=300 51404840
0.01 Scale Factor Error with Delta=300 1285121021
Priority Target DPS
Sample Data Táunks Priority Target Damage Per Second
Count 9999
Mean 217145.46
Minimum 191730.82
Maximum 255730.04
Spread ( max - min ) 63999.22
Range [ ( max - min ) / 2 * 100% ] 14.74%
Standard Deviation 7847.8109
5th Percentile 204652.74
95th Percentile 230481.62
( 95th Percentile - 5th Percentile ) 25828.88
Mean Distribution
Standard Deviation 78.4820
95.00% Confidence Intervall ( 216991.64 - 217299.29 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5017
0.1 Scale Factor Error with Delta=300 525751
0.05 Scale Factor Error with Delta=300 2103007
0.01 Scale Factor Error with Delta=300 52575175
DPS(e)
Sample Data Táunks Damage Per Second (Effective)
Count 9999
Mean 487959.63
Minimum 397252.51
Maximum 633124.36
Spread ( max - min ) 235871.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
Damage
Sample Data Táunks Damage
Count 9999
Mean 193963467.07
Minimum 157009583.99
Maximum 230152999.37
Spread ( max - min ) 73143415.38
Range [ ( max - min ) / 2 * 100% ] 18.85%
DTPS
Sample Data Táunks Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Táunks Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Táunks Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Táunks Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Táunks Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Táunks Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data TáunksTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Táunks Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 42.12 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 3.46 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
A 13.27 consume_magic
B 16.00 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
C 39.89 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
D 3.40 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
E 2.25 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
F 7.12 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
G 4.92 death_sweep,if=variable.blade_dance
H 19.29 blade_dance,if=variable.blade_dance
I 20.39 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
J 18.78 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
K 11.03 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
L 7.44 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
M 9.35 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
N 80.72 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
O 5.97 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
0.00 demons_bite
P 7.15 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
Q 1.63 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
R 1.00 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
S 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

0124569D6EAFJBKJJJJJCJJE6JJPCI6GLPB6IHCINHANNCP6NO6Q6HIBNHCI6FC7NNHCIN6ANNBI6CHMLCO6HCINNBNNP6NC6AHMNNFCI6HNBNNNCNNN6CEHIC7LCID6AHNBN6ICNNNNNCI6HCINBH6FIC6ANNNNNCII66BA6HCLIO6HMC6NNNANNNB6IHCII6NC7NRSFGCIJJAJGJ6JJCJBI6IGAJLCII6GCO6NHMNNP6BNANCI6HM6CNHFNNMBLCN6NKCDNNNANNP6CKNBNKCN6C7NNKCNO6LNB6KFCNKANNNNCK6NCNNBKNCK6NCNNNAL

Sample Sequence Table

time name target resources buffs
Pre flask Táunks 0.0/120: 0% fury
Pre food Táunks 0.0/120: 0% fury
Pre augmentation Táunks 0.0/120: 0% fury
Pre potion Fluffy_Pillow 0.0/120: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/120: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/120: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/120: 0% fury metamorphosis, blood_frenzy, potion_of_the_old_war
0:00.335 fel_barrage Fluffy_Pillow 25.0/120: 21% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:01.652 auto_attack Fluffy_Pillow 25.0/120: 21% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:01.652 throw_glaive Fluffy_Pillow 25.0/120: 21% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:02.436 consume_magic Fluffy_Pillow 25.0/120: 21% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:02.436 fury_of_the_illidari Fluffy_Pillow 75.0/120: 63% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:03.219 annihilation Fluffy_Pillow 75.0/120: 63% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:04.001 vengeful_retreat Fluffy_Pillow 35.0/120: 29% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:04.001 throw_glaive Fluffy_Pillow 35.0/120: 29% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
0:04.784 Waiting 0.100 sec 35.0/120: 29% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
0:04.884 annihilation Fluffy_Pillow 100.0/120: 83% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
0:05.664 annihilation Fluffy_Pillow 80.0/120: 67% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:06.447 annihilation Fluffy_Pillow 60.0/120: 50% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:07.230 annihilation Fluffy_Pillow 40.0/120: 33% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:08.012 Waiting 0.900 sec 0.0/120: 0% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:08.912 annihilation Fluffy_Pillow 62.0/120: 52% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:09.694 Waiting 0.400 sec 22.0/120: 18% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:10.094 fel_rush Fluffy_Pillow 22.0/120: 18% fury bloodlust, metamorphosis, potion_of_the_old_war
0:10.513 annihilation Fluffy_Pillow 47.0/120: 39% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:11.355 Waiting 0.400 sec 7.0/120: 6% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:11.755 annihilation Fluffy_Pillow 42.0/120: 35% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:12.597 throw_glaive Fluffy_Pillow 22.0/120: 18% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war
0:13.439 auto_attack Fluffy_Pillow 22.0/120: 18% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:13.439 Waiting 3.000 sec 22.0/120: 18% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:16.439 annihilation Fluffy_Pillow 58.0/120: 48% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:17.220 Waiting 1.900 sec 18.0/120: 15% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:19.120 annihilation Fluffy_Pillow 49.0/120: 41% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:19.902 Waiting 0.100 sec 9.0/120: 8% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:20.002 throw_glaive Fluffy_Pillow 9.0/120: 8% fury bloodlust, raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
0:20.783 fel_rush Fluffy_Pillow 9.0/120: 8% fury bloodlust, raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
0:21.201 throw_glaive Fluffy_Pillow 34.0/120: 28% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:21.984 Waiting 1.000 sec 34.0/120: 28% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:22.984 auto_attack Fluffy_Pillow 34.0/120: 28% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:22.984 Waiting 1.400 sec 34.0/120: 28% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:24.384 death_sweep Fluffy_Pillow 66.0/120: 55% fury bloodlust, metamorphosis, momentum, blood_frenzy
0:25.165 Waiting 0.600 sec 31.0/120: 26% fury bloodlust, metamorphosis, death_sweep, blood_frenzy
0:25.765 eye_beam Fluffy_Pillow 68.0/120: 57% fury bloodlust, metamorphosis, blood_frenzy
0:27.035 Waiting 1.000 sec 18.0/120: 15% fury bloodlust, metamorphosis
0:28.035 throw_glaive Fluffy_Pillow 34.0/120: 28% fury bloodlust, raid_movement, metamorphosis
0:28.878 vengeful_retreat Fluffy_Pillow 34.0/120: 28% fury bloodlust, raid_movement, metamorphosis
0:29.001 auto_attack Fluffy_Pillow 34.0/120: 28% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement
0:29.001 Waiting 1.200 sec 34.0/120: 28% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement
0:30.201 throw_glaive Fluffy_Pillow 34.0/120: 28% fury bloodlust, momentum, out_of_range
0:31.440 Waiting 0.900 sec 34.0/120: 28% fury bloodlust, momentum
0:32.340 blade_dance Fluffy_Pillow 64.0/120: 53% fury bloodlust, momentum
0:33.392 fel_rush Fluffy_Pillow 29.0/120: 24% fury bloodlust
0:33.819 Waiting 2.000 sec 54.0/120: 45% fury bloodlust, momentum
0:35.819 throw_glaive Fluffy_Pillow 54.0/120: 45% fury bloodlust, momentum
0:37.028 Waiting 0.700 sec 74.0/120: 62% fury bloodlust, momentum
0:37.728 chaos_strike Fluffy_Pillow 106.0/120: 88% fury bloodlust
0:38.780 Waiting 0.300 sec 66.0/120: 55% fury bloodlust
0:39.080 blade_dance Fluffy_Pillow 66.0/120: 55% fury bloodlust
0:40.379 consume_magic Fluffy_Pillow 31.0/120: 26% fury bloodlust
0:40.379 chaos_strike Fluffy_Pillow 81.0/120: 68% fury bloodlust
0:41.432 chaos_strike Fluffy_Pillow 41.0/120: 34% fury
0:42.798 Waiting 0.600 sec 1.0/120: 1% fury
0:43.398 fel_rush Fluffy_Pillow 1.0/120: 1% fury
0:43.812 Waiting 0.200 sec 26.0/120: 22% fury momentum
0:44.012 throw_glaive Fluffy_Pillow 54.0/120: 45% fury raid_movement, momentum
0:45.380 auto_attack Fluffy_Pillow 54.0/120: 45% fury momentum
0:45.380 chaos_strike Fluffy_Pillow 54.0/120: 45% fury momentum
0:46.746 fel_barrage Fluffy_Pillow 14.0/120: 12% fury momentum
0:48.413 auto_attack Fluffy_Pillow 14.0/120: 12% fury
0:48.413 Waiting 1.600 sec 14.0/120: 12% fury
0:50.013 fel_rush Fluffy_Pillow 27.0/120: 23% fury raid_movement, blood_frenzy
0:50.422 auto_attack Fluffy_Pillow 52.0/120: 43% fury momentum, blood_frenzy
0:50.422 blade_dance Fluffy_Pillow 52.0/120: 43% fury momentum, blood_frenzy
0:51.690 Waiting 0.500 sec 17.0/120: 14% fury momentum, blood_frenzy
0:52.190 throw_glaive Fluffy_Pillow 17.0/120: 14% fury momentum, blood_frenzy
0:53.638 Waiting 0.400 sec 17.0/120: 14% fury momentum, blood_frenzy
0:54.038 vengeful_retreat Fluffy_Pillow 17.0/120: 14% fury blood_frenzy
0:54.038 Waiting 3.000 sec 17.0/120: 14% fury momentum, vengeful_retreat_movement, blood_frenzy
0:57.038 chaos_strike Fluffy_Pillow 84.0/120: 70% fury momentum, blood_frenzy
0:58.309 Waiting 0.300 sec 44.0/120: 37% fury blood_frenzy
0:58.609 blade_dance Fluffy_Pillow 44.0/120: 37% fury blood_frenzy
1:00.129 fel_rush Fluffy_Pillow 9.0/120: 8% fury raid_movement
1:00.581 Waiting 0.200 sec 34.0/120: 28% fury raid_movement, momentum
1:00.781 throw_glaive Fluffy_Pillow 34.0/120: 28% fury raid_movement, momentum
1:02.318 auto_attack Fluffy_Pillow 34.0/120: 28% fury momentum
1:02.318 fury_of_the_illidari Fluffy_Pillow 34.0/120: 28% fury momentum
1:03.803 Waiting 0.400 sec 34.0/120: 28% fury momentum
1:04.203 fel_rush Fluffy_Pillow 34.0/120: 28% fury
1:04.611 blur Fluffy_Pillow 59.0/120: 49% fury momentum
1:04.611 Waiting 0.100 sec 59.0/120: 49% fury blur, momentum
1:04.711 chaos_strike Fluffy_Pillow 120.0/120: 100% fury blur, momentum
1:06.077 chaos_strike Fluffy_Pillow 100.0/120: 83% fury blur, momentum
1:07.444 Waiting 0.300 sec 60.0/120: 50% fury blur, momentum
1:07.744 blade_dance Fluffy_Pillow 60.0/120: 50% fury blur, momentum
1:09.304 fel_rush Fluffy_Pillow 25.0/120: 21% fury blur
1:09.709 Waiting 0.100 sec 50.0/120: 42% fury blur, momentum
1:09.809 throw_glaive Fluffy_Pillow 50.0/120: 42% fury blur, momentum
1:11.402 chaos_strike Fluffy_Pillow 50.0/120: 42% fury blur, momentum
1:12.769 Waiting 4.200 sec 10.0/120: 8% fury blur, momentum
1:16.969 auto_attack Fluffy_Pillow 38.0/120: 32% fury
1:16.969 Waiting 0.100 sec 38.0/120: 32% fury
1:17.069 consume_magic Fluffy_Pillow 38.0/120: 32% fury
1:17.069 chaos_strike Fluffy_Pillow 88.0/120: 73% fury
1:18.435 chaos_strike Fluffy_Pillow 68.0/120: 57% fury
1:19.801 vengeful_retreat Fluffy_Pillow 28.0/120: 23% fury
1:19.801 Waiting 0.200 sec 28.0/120: 23% fury momentum, vengeful_retreat_movement, blood_frenzy
1:20.001 throw_glaive Fluffy_Pillow 28.0/120: 23% fury raid_movement, momentum, vengeful_retreat_movement, blood_frenzy
1:21.272 Waiting 1.700 sec 28.0/120: 23% fury raid_movement, momentum, blood_frenzy
1:22.972 auto_attack Fluffy_Pillow 28.0/120: 23% fury momentum, blood_frenzy
1:22.972 Waiting 0.900 sec 28.0/120: 23% fury momentum, blood_frenzy
1:23.872 fel_rush Fluffy_Pillow 28.0/120: 23% fury blood_frenzy
1:24.294 blade_dance Fluffy_Pillow 53.0/120: 44% fury momentum, blood_frenzy
1:25.563 Waiting 2.400 sec 18.0/120: 15% fury momentum, blood_frenzy
1:27.963 throw_glaive Fluffy_Pillow 45.0/120: 38% fury blood_frenzy
1:29.473 Waiting 0.100 sec 45.0/120: 38% fury blood_frenzy
1:29.573 eye_beam Fluffy_Pillow 72.0/120: 60% fury blood_frenzy
1:31.526 Waiting 0.500 sec 22.0/120: 18% fury metamorphosis, blood_frenzy
1:32.026 fel_rush Fluffy_Pillow 67.0/120: 56% fury raid_movement, blood_frenzy
1:32.433 fel_barrage Fluffy_Pillow 92.0/120: 77% fury raid_movement, momentum, blood_frenzy
1:33.884 auto_attack Fluffy_Pillow 92.0/120: 77% fury momentum, blood_frenzy
1:33.884 blade_dance Fluffy_Pillow 92.0/120: 77% fury momentum, blood_frenzy
1:35.154 Waiting 0.900 sec 57.0/120: 48% fury momentum, blood_frenzy
1:36.054 fel_rush Fluffy_Pillow 57.0/120: 48% fury blood_frenzy
1:36.475 throw_glaive Fluffy_Pillow 82.0/120: 68% fury momentum, blood_frenzy
1:37.910 chaos_strike Fluffy_Pillow 82.0/120: 68% fury momentum, blood_frenzy
1:39.180 Waiting 0.900 sec 42.0/120: 35% fury momentum, blood_frenzy
1:40.080 chaos_strike Fluffy_Pillow 42.0/120: 35% fury blood_frenzy
1:41.349 Waiting 3.300 sec 2.0/120: 2% fury blood_frenzy
1:44.649 vengeful_retreat Fluffy_Pillow 38.0/120: 32% fury
1:44.801 Waiting 0.200 sec 38.0/120: 32% fury momentum, vengeful_retreat_movement
1:45.001 chaos_strike Fluffy_Pillow 72.0/120: 60% fury momentum, vengeful_retreat_movement
1:46.368 Waiting 1.000 sec 32.0/120: 27% fury momentum
1:47.368 chaos_strike Fluffy_Pillow 65.0/120: 54% fury momentum, blood_frenzy
1:48.638 throw_glaive Fluffy_Pillow 45.0/120: 38% fury raid_movement, momentum, blood_frenzy
1:49.907 auto_attack Fluffy_Pillow 45.0/120: 38% fury blood_frenzy
1:49.907 chaos_strike Fluffy_Pillow 45.0/120: 38% fury blood_frenzy
1:51.177 fel_rush Fluffy_Pillow 5.0/120: 4% fury raid_movement, blood_frenzy
1:51.623 Waiting 1.400 sec 30.0/120: 25% fury raid_movement, momentum, blood_frenzy
1:53.023 auto_attack Fluffy_Pillow 30.0/120: 25% fury momentum, blood_frenzy
1:53.023 Waiting 1.100 sec 30.0/120: 25% fury momentum, blood_frenzy
1:54.123 consume_magic Fluffy_Pillow 30.0/120: 25% fury momentum, blood_frenzy
1:54.123 blade_dance Fluffy_Pillow 80.0/120: 67% fury momentum, blood_frenzy
1:55.394 throw_glaive Fluffy_Pillow 45.0/120: 38% fury blood_frenzy
1:56.664 Waiting 3.000 sec 45.0/120: 38% fury blood_frenzy
1:59.664 chaos_strike Fluffy_Pillow 80.0/120: 67% fury blood_frenzy
2:00.932 Waiting 0.900 sec 40.0/120: 33% fury blood_frenzy
2:01.832 chaos_strike Fluffy_Pillow 75.0/120: 63% fury blood_frenzy
2:03.099 fury_of_the_illidari Fluffy_Pillow 55.0/120: 46% fury blood_frenzy
2:04.370 fel_rush Fluffy_Pillow 55.0/120: 46% fury raid_movement, blood_frenzy
2:04.766 throw_glaive Fluffy_Pillow 80.0/120: 67% fury raid_movement, momentum, blood_frenzy
2:06.035 auto_attack Fluffy_Pillow 80.0/120: 67% fury momentum, blood_frenzy
2:06.035 blade_dance Fluffy_Pillow 80.0/120: 67% fury momentum, blood_frenzy
2:07.303 Waiting 1.000 sec 45.0/120: 38% fury momentum, blood_frenzy
2:08.303 chaos_strike Fluffy_Pillow 120.0/120: 100% fury momentum
2:09.669 vengeful_retreat Fluffy_Pillow 80.0/120: 67% fury
2:09.801 chaos_strike Fluffy_Pillow 80.0/120: 67% fury momentum, vengeful_retreat_movement
2:11.168 chaos_strike Fluffy_Pillow 60.0/120: 50% fury momentum
2:12.536 Waiting 0.500 sec 20.0/120: 17% fury momentum
2:13.036 chaos_strike Fluffy_Pillow 53.0/120: 44% fury momentum, blood_frenzy
2:14.306 Waiting 0.100 sec 13.0/120: 11% fury blood_frenzy
2:14.406 fel_rush Fluffy_Pillow 13.0/120: 11% fury blood_frenzy
2:14.802 Waiting 0.500 sec 38.0/120: 32% fury momentum, blood_frenzy
2:15.302 chaos_strike Fluffy_Pillow 72.0/120: 60% fury momentum, blood_frenzy
2:16.571 chaos_strike Fluffy_Pillow 52.0/120: 43% fury momentum, blood_frenzy
2:17.841 Waiting 1.800 sec 32.0/120: 27% fury momentum, blood_frenzy
2:19.641 chaos_strike Fluffy_Pillow 60.0/120: 50% fury blood_frenzy
2:20.910 auto_attack Fluffy_Pillow 20.0/120: 17% fury blood_frenzy
2:20.910 fel_rush Fluffy_Pillow 20.0/120: 17% fury blood_frenzy
2:21.345 throw_glaive Fluffy_Pillow 45.0/120: 38% fury momentum, blood_frenzy
2:22.614 blade_dance Fluffy_Pillow 45.0/120: 38% fury momentum, blood_frenzy
2:23.883 throw_glaive Fluffy_Pillow 10.0/120: 8% fury momentum, blood_frenzy
2:25.153 fel_rush Fluffy_Pillow 10.0/120: 8% fury blood_frenzy
2:25.543 blur Fluffy_Pillow 35.0/120: 29% fury momentum, blood_frenzy
2:25.543 Waiting 2.000 sec 35.0/120: 29% fury blur, momentum, blood_frenzy
2:27.543 eye_beam Fluffy_Pillow 103.0/120: 86% fury blur, momentum, blood_frenzy
2:29.556 fel_rush Fluffy_Pillow 53.0/120: 44% fury blur, blood_frenzy
2:29.986 throw_glaive Fluffy_Pillow 78.0/120: 65% fury blur, momentum, blood_frenzy
2:31.256 fel_barrage Fluffy_Pillow 78.0/120: 65% fury blur, momentum, blood_frenzy
2:32.768 auto_attack Fluffy_Pillow 78.0/120: 65% fury blur, momentum, blood_frenzy
2:32.768 consume_magic Fluffy_Pillow 78.0/120: 65% fury blur, momentum, blood_frenzy
2:32.768 blade_dance Fluffy_Pillow 120.0/120: 100% fury blur, momentum, blood_frenzy
2:34.036 chaos_strike Fluffy_Pillow 85.0/120: 71% fury blur, blood_frenzy
2:35.306 vengeful_retreat Fluffy_Pillow 45.0/120: 38% fury blur, blood_frenzy
2:35.306 Waiting 0.200 sec 45.0/120: 38% fury blur, momentum, vengeful_retreat_movement, blood_frenzy
2:35.506 chaos_strike Fluffy_Pillow 93.0/120: 78% fury blur, momentum, vengeful_retreat_movement, blood_frenzy
2:36.775 Waiting 0.200 sec 53.0/120: 44% fury raid_movement, momentum, blood_frenzy
2:36.975 auto_attack Fluffy_Pillow 53.0/120: 44% fury momentum, blood_frenzy
2:36.975 Waiting 1.100 sec 53.0/120: 44% fury momentum, blood_frenzy
2:38.075 throw_glaive Fluffy_Pillow 53.0/120: 44% fury momentum, blood_frenzy
2:39.499 fel_rush Fluffy_Pillow 53.0/120: 44% fury blood_frenzy
2:39.890 chaos_strike Fluffy_Pillow 78.0/120: 65% fury momentum, blood_frenzy
2:41.160 chaos_strike Fluffy_Pillow 58.0/120: 48% fury momentum, blood_frenzy
2:42.429 Waiting 1.200 sec 38.0/120: 32% fury momentum, blood_frenzy
2:43.629 chaos_strike Fluffy_Pillow 69.0/120: 57% fury blood_frenzy
2:44.898 Waiting 0.900 sec 29.0/120: 24% fury blood_frenzy
2:45.798 chaos_strike Fluffy_Pillow 76.0/120: 63% fury blood_frenzy
2:47.067 Waiting 0.900 sec 36.0/120: 30% fury blood_frenzy
2:47.967 chaos_strike Fluffy_Pillow 69.0/120: 57% fury blood_frenzy
2:49.236 Waiting 0.400 sec 29.0/120: 24% fury
2:49.636 fel_rush Fluffy_Pillow 29.0/120: 24% fury
2:50.077 throw_glaive Fluffy_Pillow 54.0/120: 45% fury raid_movement, momentum
2:51.444 Waiting 1.100 sec 54.0/120: 45% fury raid_movement, momentum
2:52.544 auto_attack Fluffy_Pillow 54.0/120: 45% fury momentum
2:52.544 blade_dance Fluffy_Pillow 54.0/120: 45% fury momentum
2:53.909 fel_rush Fluffy_Pillow 19.0/120: 16% fury
2:54.297 Waiting 0.600 sec 44.0/120: 37% fury momentum
2:54.897 throw_glaive Fluffy_Pillow 44.0/120: 37% fury momentum
2:56.469 Waiting 3.200 sec 58.0/120: 48% fury momentum
2:59.669 chaos_strike Fluffy_Pillow 91.0/120: 76% fury
3:01.035 vengeful_retreat Fluffy_Pillow 51.0/120: 43% fury
3:01.035 Waiting 0.400 sec 51.0/120: 43% fury momentum, vengeful_retreat_movement
3:01.435 blade_dance Fluffy_Pillow 51.0/120: 43% fury momentum, vengeful_retreat_movement
3:02.993 auto_attack Fluffy_Pillow 16.0/120: 13% fury momentum
3:02.993 fury_of_the_illidari Fluffy_Pillow 16.0/120: 13% fury momentum
3:04.465 throw_glaive Fluffy_Pillow 16.0/120: 13% fury momentum
3:05.831 Waiting 2.200 sec 16.0/120: 13% fury
3:08.031 fel_rush Fluffy_Pillow 33.0/120: 28% fury raid_movement
3:08.424 Waiting 0.600 sec 58.0/120: 48% fury raid_movement, momentum
3:09.024 auto_attack Fluffy_Pillow 58.0/120: 48% fury momentum
3:09.024 Waiting 0.100 sec 58.0/120: 48% fury momentum
3:09.124 consume_magic Fluffy_Pillow 58.0/120: 48% fury momentum
3:09.124 chaos_strike Fluffy_Pillow 108.0/120: 90% fury momentum
3:10.492 chaos_strike Fluffy_Pillow 88.0/120: 73% fury momentum
3:11.860 chaos_strike Fluffy_Pillow 48.0/120: 40% fury momentum
3:13.224 Waiting 0.600 sec 8.0/120: 7% fury
3:13.824 chaos_strike Fluffy_Pillow 41.0/120: 34% fury
3:15.191 Waiting 3.300 sec 1.0/120: 1% fury
3:18.491 chaos_strike Fluffy_Pillow 47.0/120: 39% fury
3:19.856 fel_rush Fluffy_Pillow 7.0/120: 6% fury
3:20.284 throw_glaive Fluffy_Pillow 32.0/120: 27% fury raid_movement, momentum
3:21.650 Waiting 0.500 sec 32.0/120: 27% fury raid_movement, momentum
3:22.150 throw_glaive Fluffy_Pillow 32.0/120: 27% fury raid_movement, momentum
3:23.722 auto_attack Fluffy_Pillow 32.0/120: 27% fury momentum, blood_frenzy
3:23.722 Waiting 1.300 sec 32.0/120: 27% fury momentum, blood_frenzy
3:25.022 auto_attack Fluffy_Pillow 32.0/120: 27% fury blood_frenzy
3:25.022 Waiting 0.800 sec 32.0/120: 27% fury blood_frenzy
3:25.822 vengeful_retreat Fluffy_Pillow 32.0/120: 27% fury blood_frenzy
3:26.035 Waiting 1.100 sec 32.0/120: 27% fury momentum, vengeful_retreat_movement, blood_frenzy
3:27.135 consume_magic Fluffy_Pillow 32.0/120: 27% fury momentum, out_of_range, blood_frenzy
3:27.135 Waiting 0.200 sec 82.0/120: 68% fury momentum, out_of_range, blood_frenzy
3:27.335 auto_attack Fluffy_Pillow 82.0/120: 68% fury momentum, blood_frenzy
3:27.335 blade_dance Fluffy_Pillow 82.0/120: 68% fury momentum, blood_frenzy
3:28.605 Waiting 1.500 sec 47.0/120: 39% fury momentum, blood_frenzy
3:30.105 fel_rush Fluffy_Pillow 78.0/120: 65% fury blood_frenzy
3:30.533 eye_beam Fluffy_Pillow 103.0/120: 86% fury momentum, blood_frenzy
3:32.410 throw_glaive Fluffy_Pillow 53.0/120: 44% fury metamorphosis, momentum
3:33.778 fel_barrage Fluffy_Pillow 53.0/120: 44% fury momentum
3:35.386 auto_attack Fluffy_Pillow 53.0/120: 44% fury
3:35.386 Waiting 0.400 sec 53.0/120: 44% fury
3:35.786 blade_dance Fluffy_Pillow 53.0/120: 44% fury
3:37.400 Waiting 1.600 sec 46.0/120: 38% fury
3:39.000 throw_glaive Fluffy_Pillow 46.0/120: 38% fury
3:40.597 fel_rush Fluffy_Pillow 46.0/120: 38% fury raid_movement, blood_frenzy
3:40.940 Waiting 0.100 sec 71.0/120: 59% fury raid_movement, momentum, blood_frenzy
3:41.040 auto_attack Fluffy_Pillow 71.0/120: 59% fury momentum, blood_frenzy
3:41.040 chaos_strike Fluffy_Pillow 71.0/120: 59% fury momentum, blood_frenzy
3:42.310 Waiting 1.000 sec 31.0/120: 26% fury momentum, blood_frenzy
3:43.310 chaos_strike Fluffy_Pillow 59.0/120: 49% fury momentum, blood_frenzy
3:44.580 Waiting 0.900 sec 39.0/120: 33% fury momentum, blood_frenzy
3:45.480 chaos_strike Fluffy_Pillow 71.0/120: 59% fury blood_frenzy
3:46.750 consume_magic Fluffy_Pillow 51.0/120: 43% fury blood_frenzy
3:46.750 chaos_strike Fluffy_Pillow 101.0/120: 84% fury blood_frenzy
3:48.021 chaos_strike Fluffy_Pillow 61.0/120: 51% fury blood_frenzy
3:49.291 Waiting 0.600 sec 21.0/120: 18% fury
3:49.891 chaos_strike Fluffy_Pillow 70.0/120: 58% fury
3:51.258 vengeful_retreat Fluffy_Pillow 30.0/120: 25% fury raid_movement
3:51.258 auto_attack Fluffy_Pillow 30.0/120: 25% fury momentum, vengeful_retreat_movement
3:51.258 throw_glaive Fluffy_Pillow 30.0/120: 25% fury momentum, vengeful_retreat_movement
3:52.625 Waiting 1.000 sec 30.0/120: 25% fury momentum
3:53.625 blade_dance Fluffy_Pillow 64.0/120: 53% fury momentum
3:54.991 Waiting 0.300 sec 29.0/120: 24% fury momentum
3:55.291 fel_rush Fluffy_Pillow 29.0/120: 24% fury
3:55.685 Waiting 0.200 sec 54.0/120: 45% fury momentum
3:55.885 throw_glaive Fluffy_Pillow 54.0/120: 45% fury momentum
3:56.004 throw_glaive Fluffy_Pillow 88.0/120: 73% fury raid_movement, momentum
3:57.472 auto_attack Fluffy_Pillow 88.0/120: 73% fury momentum
3:57.472 chaos_strike Fluffy_Pillow 88.0/120: 73% fury momentum
3:58.837 Waiting 0.500 sec 68.0/120: 57% fury momentum
3:59.337 fel_rush Fluffy_Pillow 68.0/120: 57% fury
3:59.726 blur Fluffy_Pillow 93.0/120: 78% fury momentum
3:59.726 chaos_strike Fluffy_Pillow 93.0/120: 78% fury blur, momentum
4:01.094 Waiting 1.200 sec 73.0/120: 61% fury blur, momentum
4:02.294 metamorphosis Fluffy_Pillow 101.0/120: 84% fury blur, momentum, blood_frenzy
4:03.366 potion Fluffy_Pillow 101.0/120: 84% fury metamorphosis, blur, blood_frenzy
4:03.366 fury_of_the_illidari Fluffy_Pillow 101.0/120: 84% fury metamorphosis, blur, blood_frenzy, potion_of_the_old_war
4:04.383 death_sweep Fluffy_Pillow 101.0/120: 84% fury metamorphosis, blur, blood_frenzy, potion_of_the_old_war
4:05.399 fel_rush Fluffy_Pillow 66.0/120: 55% fury metamorphosis, blur, blood_frenzy, potion_of_the_old_war
4:05.776 throw_glaive Fluffy_Pillow 91.0/120: 76% fury metamorphosis, blur, momentum, blood_frenzy, potion_of_the_old_war
4:06.793 annihilation Fluffy_Pillow 91.0/120: 76% fury metamorphosis, blur, momentum, blood_frenzy, potion_of_the_old_war
4:07.810 Waiting 0.100 sec 51.0/120: 43% fury metamorphosis, blur, momentum, blood_frenzy, potion_of_the_old_war
4:07.910 annihilation Fluffy_Pillow 85.0/120: 71% fury metamorphosis, blur, momentum, blood_frenzy, potion_of_the_old_war
4:08.926 consume_magic Fluffy_Pillow 45.0/120: 38% fury metamorphosis, blur, momentum, blood_frenzy, potion_of_the_old_war
4:08.926 annihilation Fluffy_Pillow 95.0/120: 79% fury metamorphosis, blur, momentum, blood_frenzy, potion_of_the_old_war
4:09.941 death_sweep Fluffy_Pillow 55.0/120: 46% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:10.959 Waiting 0.500 sec 20.0/120: 17% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:11.459 annihilation Fluffy_Pillow 82.0/120: 68% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:12.476 Waiting 0.500 sec 42.0/120: 35% fury raid_movement, metamorphosis, potion_of_the_old_war
4:12.976 auto_attack Fluffy_Pillow 42.0/120: 35% fury metamorphosis, potion_of_the_old_war
4:12.976 annihilation Fluffy_Pillow 42.0/120: 35% fury metamorphosis, potion_of_the_old_war
4:14.069 Waiting 0.800 sec 22.0/120: 18% fury metamorphosis, potion_of_the_old_war
4:14.869 annihilation Fluffy_Pillow 51.0/120: 43% fury metamorphosis, potion_of_the_old_war
4:15.963 fel_rush Fluffy_Pillow 11.0/120: 9% fury metamorphosis, potion_of_the_old_war
4:16.342 Waiting 0.500 sec 36.0/120: 30% fury metamorphosis, momentum, potion_of_the_old_war
4:16.842 annihilation Fluffy_Pillow 54.0/120: 45% fury metamorphosis, momentum, potion_of_the_old_war
4:17.936 Waiting 2.100 sec 34.0/120: 28% fury metamorphosis, momentum, potion_of_the_old_war
4:20.036 vengeful_retreat Fluffy_Pillow 34.0/120: 28% fury raid_movement, metamorphosis, potion_of_the_old_war
4:20.036 throw_glaive Fluffy_Pillow 34.0/120: 28% fury raid_movement, metamorphosis, momentum, vengeful_retreat_movement, potion_of_the_old_war
4:21.132 auto_attack Fluffy_Pillow 34.0/120: 28% fury metamorphosis, momentum, potion_of_the_old_war
4:21.132 throw_glaive Fluffy_Pillow 34.0/120: 28% fury metamorphosis, momentum, potion_of_the_old_war
4:22.227 Waiting 0.800 sec 34.0/120: 28% fury metamorphosis, momentum, potion_of_the_old_war
4:23.027 death_sweep Fluffy_Pillow 67.0/120: 56% fury metamorphosis, momentum, potion_of_the_old_war
4:24.120 consume_magic Fluffy_Pillow 32.0/120: 27% fury metamorphosis, potion_of_the_old_war
4:24.120 annihilation Fluffy_Pillow 82.0/120: 68% fury metamorphosis, potion_of_the_old_war
4:25.214 eye_beam Fluffy_Pillow 62.0/120: 52% fury metamorphosis, potion_of_the_old_war
4:26.974 fel_rush Fluffy_Pillow 12.0/120: 10% fury metamorphosis, potion_of_the_old_war
4:27.392 Waiting 0.400 sec 37.0/120: 31% fury metamorphosis, momentum, potion_of_the_old_war
4:27.792 throw_glaive Fluffy_Pillow 37.0/120: 31% fury metamorphosis, momentum, potion_of_the_old_war
4:28.003 throw_glaive Fluffy_Pillow 37.0/120: 31% fury raid_movement, metamorphosis, momentum, potion_of_the_old_war
4:29.134 auto_attack Fluffy_Pillow 37.0/120: 31% fury metamorphosis, momentum
4:29.134 death_sweep Fluffy_Pillow 37.0/120: 31% fury metamorphosis, momentum
4:30.228 Waiting 0.800 sec 2.0/120: 2% fury metamorphosis, momentum
4:31.028 fel_rush Fluffy_Pillow 39.0/120: 33% fury metamorphosis
4:31.500 Waiting 0.800 sec 64.0/120: 53% fury metamorphosis, momentum
4:32.300 fel_barrage Fluffy_Pillow 64.0/120: 53% fury momentum
4:33.906 auto_attack Fluffy_Pillow 64.0/120: 53% fury momentum
4:33.906 Waiting 0.600 sec 64.0/120: 53% fury momentum
4:34.506 chaos_strike Fluffy_Pillow 102.0/120: 85% fury momentum
4:35.872 blade_dance Fluffy_Pillow 62.0/120: 52% fury
4:37.239 throw_glaive Fluffy_Pillow 27.0/120: 23% fury
4:38.605 Waiting 1.400 sec 27.0/120: 23% fury
4:40.005 chaos_strike Fluffy_Pillow 55.0/120: 46% fury
4:41.370 Waiting 0.400 sec 15.0/120: 13% fury blood_frenzy
4:41.770 chaos_strike Fluffy_Pillow 45.0/120: 38% fury blood_frenzy
4:43.040 Waiting 1.000 sec 5.0/120: 4% fury blood_frenzy
4:44.040 throw_glaive Fluffy_Pillow 36.0/120: 30% fury raid_movement, blood_frenzy
4:45.309 auto_attack Fluffy_Pillow 36.0/120: 30% fury blood_frenzy
4:45.309 vengeful_retreat Fluffy_Pillow 36.0/120: 30% fury blood_frenzy
4:45.309 Waiting 2.200 sec 36.0/120: 30% fury momentum, vengeful_retreat_movement, blood_frenzy
4:47.509 chaos_strike Fluffy_Pillow 50.0/120: 42% fury momentum, blood_frenzy
4:48.778 Waiting 0.400 sec 10.0/120: 8% fury momentum, blood_frenzy
4:49.178 consume_magic Fluffy_Pillow 10.0/120: 8% fury momentum, blood_frenzy
4:49.178 chaos_strike Fluffy_Pillow 60.0/120: 50% fury momentum, blood_frenzy
4:50.447 fel_rush Fluffy_Pillow 20.0/120: 17% fury raid_movement
4:50.827 throw_glaive Fluffy_Pillow 45.0/120: 38% fury raid_movement, momentum
4:52.254 Waiting 0.700 sec 45.0/120: 38% fury raid_movement, momentum
4:52.954 auto_attack Fluffy_Pillow 45.0/120: 38% fury momentum
4:52.954 blade_dance Fluffy_Pillow 45.0/120: 38% fury momentum
4:54.321 Waiting 5.500 sec 10.0/120: 8% fury momentum
4:59.821 throw_glaive Fluffy_Pillow 63.0/120: 53% fury
5:01.338 auto_attack Fluffy_Pillow 63.0/120: 53% fury
5:01.338 fel_rush Fluffy_Pillow 63.0/120: 53% fury
5:01.717 chaos_strike Fluffy_Pillow 88.0/120: 73% fury momentum
5:03.084 blade_dance Fluffy_Pillow 48.0/120: 40% fury momentum
5:04.450 fury_of_the_illidari Fluffy_Pillow 13.0/120: 11% fury momentum
5:05.816 Waiting 0.300 sec 13.0/120: 11% fury
5:06.116 chaos_strike Fluffy_Pillow 79.0/120: 66% fury blood_frenzy
5:07.386 Waiting 0.900 sec 59.0/120: 49% fury blood_frenzy
5:08.286 chaos_strike Fluffy_Pillow 79.0/120: 66% fury blood_frenzy
5:09.555 throw_glaive Fluffy_Pillow 39.0/120: 33% fury blood_frenzy
5:10.825 vengeful_retreat Fluffy_Pillow 39.0/120: 33% fury blood_frenzy
5:10.825 Waiting 1.900 sec 39.0/120: 33% fury momentum, vengeful_retreat_movement, blood_frenzy
5:12.725 eye_beam Fluffy_Pillow 55.0/120: 46% fury momentum, blood_frenzy
5:14.663 Waiting 0.200 sec 5.0/120: 4% fury metamorphosis, momentum, blood_frenzy
5:14.863 fel_rush Fluffy_Pillow 40.0/120: 33% fury blood_frenzy
5:15.246 chaos_strike Fluffy_Pillow 65.0/120: 54% fury momentum, blood_frenzy
5:16.516 Waiting 0.500 sec 45.0/120: 38% fury raid_movement, momentum
5:17.016 auto_attack Fluffy_Pillow 45.0/120: 38% fury momentum
5:17.016 chaos_strike Fluffy_Pillow 45.0/120: 38% fury momentum
5:18.382 throw_glaive Fluffy_Pillow 5.0/120: 4% fury momentum
5:19.748 fel_rush Fluffy_Pillow 5.0/120: 4% fury
5:20.137 fel_barrage Fluffy_Pillow 30.0/120: 25% fury momentum
5:21.816 chaos_strike Fluffy_Pillow 70.0/120: 58% fury momentum, blood_frenzy
5:23.086 Waiting 0.900 sec 30.0/120: 25% fury momentum, blood_frenzy
5:23.986 chaos_strike Fluffy_Pillow 80.0/120: 67% fury blood_frenzy
5:25.257 chaos_strike Fluffy_Pillow 40.0/120: 33% fury blood_frenzy
5:26.527 Waiting 3.700 sec 0.0/120: 0% fury blood_frenzy
5:30.227 consume_magic Fluffy_Pillow 30.0/120: 25% fury blood_frenzy
5:30.227 chaos_strike Fluffy_Pillow 80.0/120: 67% fury blood_frenzy
5:31.496 chaos_strike Fluffy_Pillow 40.0/120: 33% fury blood_frenzy
5:32.767 throw_glaive Fluffy_Pillow 20.0/120: 17% fury raid_movement, blood_frenzy
5:34.036 auto_attack Fluffy_Pillow 20.0/120: 17% fury blood_frenzy
5:34.036 Waiting 0.900 sec 20.0/120: 17% fury blood_frenzy
5:34.936 fel_rush Fluffy_Pillow 20.0/120: 17% fury blood_frenzy
5:35.346 throw_glaive Fluffy_Pillow 45.0/120: 38% fury momentum, blood_frenzy
5:36.617 chaos_strike Fluffy_Pillow 45.0/120: 38% fury momentum, blood_frenzy
5:37.888 Waiting 1.100 sec 5.0/120: 4% fury momentum, blood_frenzy
5:38.988 vengeful_retreat Fluffy_Pillow 30.0/120: 25% fury blood_frenzy
5:38.988 Waiting 1.700 sec 30.0/120: 25% fury momentum, vengeful_retreat_movement, blood_frenzy
5:40.688 chaos_strike Fluffy_Pillow 62.0/120: 52% fury momentum, blood_frenzy
5:41.957 Waiting 0.800 sec 22.0/120: 18% fury momentum, blood_frenzy
5:42.757 throw_glaive Fluffy_Pillow 22.0/120: 18% fury momentum, blood_frenzy
5:44.263 Waiting 0.700 sec 22.0/120: 18% fury blood_frenzy
5:44.963 fel_rush Fluffy_Pillow 22.0/120: 18% fury
5:45.327 chaos_strike Fluffy_Pillow 47.0/120: 39% fury momentum
5:46.694 Waiting 2.300 sec 7.0/120: 6% fury momentum
5:48.994 auto_attack Fluffy_Pillow 38.0/120: 32% fury
5:48.994 fel_rush Fluffy_Pillow 38.0/120: 32% fury
5:49.415 blur Fluffy_Pillow 63.0/120: 53% fury momentum
5:49.415 chaos_strike Fluffy_Pillow 63.0/120: 53% fury blur, momentum
5:50.781 Waiting 0.600 sec 23.0/120: 19% fury blur, momentum
5:51.381 chaos_strike Fluffy_Pillow 43.0/120: 36% fury blur, momentum
5:52.748 throw_glaive Fluffy_Pillow 23.0/120: 19% fury blur, momentum
5:54.116 fel_rush Fluffy_Pillow 23.0/120: 19% fury blur
5:54.509 chaos_strike Fluffy_Pillow 48.0/120: 40% fury blur, momentum
5:55.877 fel_barrage Fluffy_Pillow 28.0/120: 23% fury blur, momentum
5:57.499 auto_attack Fluffy_Pillow 28.0/120: 23% fury blur, momentum
5:57.499 Waiting 0.600 sec 28.0/120: 23% fury blur, momentum
5:58.099 eye_beam Fluffy_Pillow 60.0/120: 50% fury blur, momentum
6:00.207 Waiting 2.600 sec 10.0/120: 8% fury
6:02.807 chaos_strike Fluffy_Pillow 56.0/120: 47% fury
6:04.173 vengeful_retreat Fluffy_Pillow 16.0/120: 13% fury raid_movement
6:04.173 auto_attack Fluffy_Pillow 16.0/120: 13% fury momentum, vengeful_retreat_movement, blood_frenzy
6:04.173 throw_glaive Fluffy_Pillow 16.0/120: 13% fury momentum, vengeful_retreat_movement, blood_frenzy
6:05.443 fury_of_the_illidari Fluffy_Pillow 16.0/120: 13% fury momentum, blood_frenzy
6:06.712 Waiting 1.500 sec 16.0/120: 13% fury momentum, blood_frenzy
6:08.212 fel_rush Fluffy_Pillow 16.0/120: 13% fury blood_frenzy
6:08.670 chaos_strike Fluffy_Pillow 41.0/120: 34% fury momentum, blood_frenzy
6:09.939 throw_glaive Fluffy_Pillow 1.0/120: 1% fury momentum, blood_frenzy
6:11.367 consume_magic Fluffy_Pillow 1.0/120: 1% fury momentum, blood_frenzy
6:11.367 chaos_strike Fluffy_Pillow 51.0/120: 43% fury momentum, blood_frenzy
6:12.637 Waiting 0.400 sec 31.0/120: 26% fury blood_frenzy
6:13.037 chaos_strike Fluffy_Pillow 63.0/120: 53% fury blood_frenzy
6:14.307 Waiting 1.000 sec 23.0/120: 19% fury
6:15.307 chaos_strike Fluffy_Pillow 54.0/120: 45% fury
6:16.672 Waiting 1.000 sec 34.0/120: 28% fury
6:17.672 chaos_strike Fluffy_Pillow 61.0/120: 51% fury
6:19.039 fel_rush Fluffy_Pillow 21.0/120: 18% fury
6:19.446 throw_glaive Fluffy_Pillow 46.0/120: 38% fury momentum, blood_frenzy
6:20.716 Waiting 0.300 sec 46.0/120: 38% fury raid_movement, momentum, blood_frenzy
6:21.016 auto_attack Fluffy_Pillow 46.0/120: 38% fury momentum, blood_frenzy
6:21.016 chaos_strike Fluffy_Pillow 46.0/120: 38% fury momentum, blood_frenzy
6:22.286 Waiting 0.800 sec 26.0/120: 22% fury momentum, blood_frenzy
6:23.086 fel_rush Fluffy_Pillow 26.0/120: 22% fury blood_frenzy
6:23.526 chaos_strike Fluffy_Pillow 51.0/120: 43% fury momentum, blood_frenzy
6:24.796 Waiting 0.700 sec 31.0/120: 26% fury momentum, blood_frenzy
6:25.496 chaos_strike Fluffy_Pillow 61.0/120: 51% fury momentum, blood_frenzy
6:26.763 Waiting 2.200 sec 21.0/120: 18% fury momentum, blood_frenzy
6:28.963 vengeful_retreat Fluffy_Pillow 36.0/120: 30% fury blood_frenzy
6:29.173 throw_glaive Fluffy_Pillow 36.0/120: 30% fury momentum, vengeful_retreat_movement
6:30.542 Waiting 1.700 sec 36.0/120: 30% fury momentum
6:32.242 chaos_strike Fluffy_Pillow 68.0/120: 57% fury momentum
6:33.608 Waiting 2.400 sec 28.0/120: 23% fury
6:36.008 fel_rush Fluffy_Pillow 28.0/120: 23% fury raid_movement
6:36.444 throw_glaive Fluffy_Pillow 53.0/120: 44% fury raid_movement, momentum
6:37.811 auto_attack Fluffy_Pillow 53.0/120: 44% fury momentum
6:37.811 chaos_strike Fluffy_Pillow 53.0/120: 44% fury momentum
6:39.179 Waiting 0.900 sec 33.0/120: 28% fury momentum
6:40.079 fel_rush Fluffy_Pillow 33.0/120: 28% fury
6:40.518 chaos_strike Fluffy_Pillow 58.0/120: 48% fury momentum
6:41.884 Waiting 0.700 sec 38.0/120: 32% fury momentum
6:42.584 chaos_strike Fluffy_Pillow 68.0/120: 57% fury momentum
6:43.952 Waiting 1.000 sec 28.0/120: 23% fury momentum
6:44.952 chaos_strike Fluffy_Pillow 44.0/120: 37% fury
6:46.319 Waiting 4.900 sec 4.0/120: 3% fury
6:51.219 consume_magic Fluffy_Pillow 32.0/120: 27% fury
6:51.219 eye_beam Fluffy_Pillow 82.0/120: 68% fury

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25204 23498 13348 (8316)
Stamina 32346 32346 19827
Intellect 5328 5003 0
Spirit 2 2 0
Health 1940760 1940760 0
Fury 120 120 0
Crit 41.90% 40.83% 8691
Haste 10.08% 10.08% 3277
Damage / Heal Versatility 1.50% 1.50% 599
Attack Power 25204 23498 0
Mastery 21.20% 21.20% 4621
Armor 2042 2042 2042
Run Speed 8 0 0
Leech 1.37% 1.37% 314

Gear

Source Slot Average Item Level: 856.00
Local Head Vindictive Gladiator's Felskin Helm of the Quickblade
ilevel: 845, stats: { 263 Armor, +1238 Agi, +1857 Sta, +915 Crit, +366 Vers }
Local Neck Cursed Beartooth Necklace
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Haste }
Local Shoulders Mana-Saber Hide Shoulders
ilevel: 835, stats: { 235 Armor, +846 AgiInt, +1269 Sta, +621 Mastery, +304 Crit, +397 Avoidance }
Local Chest Chestguard of Insidious Desire
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +792 Crit, +512 Mastery }
Local Waist Forest-Lord's Waistwrap
ilevel: 865, stats: { 195 Armor, +1678 Sta, +1119 AgiInt, +673 Haste, +362 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 865, stats: { 303 Armor, +2237 Sta, +1491 AgiInt, +986 Crit, +394 Mastery }
Local Feet Biornskin Moccasins
ilevel: 845, stats: { 223 Armor, +929 AgiInt, +1393 Sta, +686 Crit, +274 Mastery }
Local Wrists Wristwraps of Broken Trust
ilevel: 855, stats: { 146 Armor, +1147 Sta, +765 AgiInt, +454 Mastery, +294 Crit }
Local Hands Cruel Vice Grips
ilevel: 860, stats: { 213 Armor, +1601 Sta, +1068 AgiInt, +595 Crit, +421 Mastery }
Local Finger1 Ring of Frozen Magic
ilevel: 870, stats: { +1319 Sta, +1188 Haste, +791 Crit }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste, +314 Leech }
Local Trinket1 Three-Toed Rabbit Foot
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }
Local Back Drape of the Mana-Starved
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Vers }
Local Main Hand Twinblades of the Deceiver
ilevel: 869, weapon: { 3933 - 7306, 2.6 }, stats: { +664 Agi, +996 Sta, +305 Crit, +293 Mastery }, relics: { +39 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 869, weapon: { 3933 - 7306, 2.6 }, stats: { +664 Agi, +996 Sta, +305 Crit, +293 Mastery }

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Táunks"
origin="https://us.api.battle.net/wow/character/thrall/Táunks/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/107/157266795-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=skinning=800
talents=1233112
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1000:2:1001:3:1002:3:1003:3:1004:3:1006:3:1007:3:1010:1:1011:1:1012:1:1013:1:1014:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=vindictive_gladiators_felskin_helm,id=136289,bonus_id=3428/1676/1477/3336
neck=cursed_beartooth_necklace,id=139239,bonus_id=1807/1472
shoulders=manasaber_hide_shoulders,id=134330,bonus_id=3432/40/1497/1674
back=drape_of_the_manastarved,id=141543,bonus_id=1472
chest=chestguard_of_insidious_desire,id=137514,bonus_id=1727/1502/3336
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1807/1477/3336
hands=cruel_vice_grips,id=133617,bonus_id=1727/1512/3337
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1487/3337
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1487/3337
feet=biornskin_moccasins,id=134193,bonus_id=3474/1507/1674
finger1=ring_of_frozen_magic,id=141533,bonus_id=1482/3336
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1807/41/1472
trinket1=threetoed_rabbit_foot,id=134203,bonus_id=3432/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1808/1472
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141277/136719/141255/0,relic_id=3432:1497:1674/1727:1492:1813/3432:1502:3336/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=855.50
# gear_agility=13348
# gear_stamina=19827
# gear_crit_rating=8691
# gear_haste_rating=3277
# gear_mastery_rating=4621
# gear_versatility_rating=599
# gear_leech_rating=314
# gear_avoidance_rating=397
# gear_armor=2042

Illistan

Illistan : 205588 dps, 128917 dps to main target, 61388 dtps, 0 hps (0 aps), 61.6k TMI, 63.9k ETMI

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Vengeance
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
205587.9 205587.9 211.4 / 0.103% 40154.3 / 19.5% 24403.3
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
61387.6 40.86 / 0.07% 8070 / 13.1%       61.6k 12 / 0.02% 59.1k 64.0k 2.4k / 4.0%       20.6% 13.9% 31.0% 20.0       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.4 8.4 Pain 3.70% 60.1 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Illistan/advanced
Talents
  • 15: Agonizing Flames (Vengeance Demon Hunter)
  • 30: Feast of Souls (Vengeance Demon Hunter)
  • 45: Felblade
  • 60: Feed the Demon (Vengeance Demon Hunter)
  • 75: Concentrated Sigils (Vengeance Demon Hunter)
  • 90: Fel Devastation (Vengeance Demon Hunter)
  • 100: Last Resort (Vengeance Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • herbalism: 339
  • enchanting: 59
Scale Factors for Illistan Damage Taken Per Second
Agi Crit Mastery Haste Vers
Scale Factors -0.28 -0.44 -0.55 -0.76 -0.82
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.28, CritRating=-0.44, HasteRating=-0.76, MasteryRating=-0.55, Versatility=-0.82 )

Scale Factors for other metrics

Scale Factors for Illistan Damage Per Second
Agi Vers Mastery Crit Haste
Scale Factors 7.75 4.69 4.55 4.15 3.24
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.27 0.27 0.27 0.27 0.26
Gear Ranking
Optimizers
Ranking
  • Agi > Vers ~= Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=7.75, CritRating=4.15, HasteRating=3.24, MasteryRating=4.55, Versatility=4.69 )
Scale Factors for Illistan Priority Target Damage Per Second
Agi Vers Mastery Haste Crit
Scale Factors 4.61 2.96 2.71 2.65 2.65
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.06 0.06 0.06 0.06 0.06
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Mastery > Haste ~= Crit
Pawn string ( Pawn: v1: "Illistan": Agility=4.61, CritRating=2.65, HasteRating=2.65, MasteryRating=2.71, Versatility=2.96 )
Scale Factors for Illistan Damage Per Second (Effective)
Agi Vers Mastery Crit Haste
Scale Factors 7.75 4.69 4.55 4.15 3.24
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=7.75, CritRating=4.15, HasteRating=3.24, MasteryRating=4.55, Versatility=4.69 )
Scale Factors for Illistan Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Damage Taken Per Second
Agi Crit Mastery Haste Vers
Scale Factors -0.28 -0.44 -0.55 -0.76 -0.82
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.28, CritRating=-0.44, HasteRating=-0.76, MasteryRating=-0.55, Versatility=-0.82 )
Scale Factors for Illistan Damage Taken
Agi Crit Mastery Haste Vers
Scale Factors -109.72 -171.31 -217.58 -303.80 -327.03
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-109.72, CritRating=-171.31, HasteRating=-303.80, MasteryRating=-217.58, Versatility=-327.03 )
Scale Factors for Illistan Healing Taken Per Second
Agi Crit Mastery Haste Vers
Scale Factors -0.24 -0.41 -0.51 -0.71 -0.77
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.24, CritRating=-0.41, HasteRating=-0.71, MasteryRating=-0.51, Versatility=-0.77 )
Scale Factors for Illistan Theck-Meloree Index
Agi Crit Haste Mastery Vers
Scale Factors -0.45 -0.27 -0.51 -0.35 -0.39
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Haste > Mastery > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.45, CritRating=-0.27, HasteRating=-0.51, MasteryRating=-0.35, Versatility=-0.39 )
Scale Factors for IllistanTheck-Meloree Index (Effective)
Agi Crit Haste Mastery Vers
Scale Factors -0.11 -0.07 -0.20 -0.11 -0.14
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.01 0.01 0.01 0.01 0.01
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Haste > Mastery > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.11, CritRating=-0.07, HasteRating=-0.20, MasteryRating=-0.11, Versatility=-0.14 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Illistan 205588
auto_attack_mh 9762 4.8% 147.9 2.72sec 26472 12334 Direct 147.9 21362 42726 26472 42.9% 19.0% 6.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.92 147.92 0.00 0.00 2.1463 0.0000 3915815.57 5889205.97 33.51 12333.86 12333.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.10 35.22% 21854.78 21855 21855 21854.78 21855 21855 1138667 1673949 31.98
hit (blocked) 4.24 2.86% 15298.35 15298 15298 15041.31 0 15298 64804 136098 51.50
crit 58.72 39.70% 43709.57 43710 43710 43709.57 43710 43710 2566708 3773303 31.98
crit (blocked) 4.76 3.22% 30596.70 30597 30597 30342.72 0 30597 145636 305856 51.95
miss 28.10 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4572 2.2% 138.6 2.90sec 13230 5759 Direct 138.6 10680 21365 13229 42.9% 19.0% 6.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.63 138.63 0.00 0.00 2.2971 0.0000 1834032.10 2758206.32 33.51 5759.25 5759.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.80 35.20% 10927.39 10927 10927 10927.39 10927 10927 533294 783992 31.98
hit (blocked) 3.98 2.87% 7649.17 7649 7649 7490.82 0 7649 30456 63962 51.30
crit 55.01 39.68% 21854.78 21855 21855 21854.78 21855 21855 1202323 1767529 31.98
crit (blocked) 4.44 3.20% 15298.35 15298 15298 15094.86 0 15298 67959 142723 51.69
miss 26.39 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Felblade 12337 6.0% 40.3 10.00sec 122691 91848 Direct 40.3 85820 171646 122692 43.0% 0.0% 7.5%  

Stats details: felblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.28 40.28 0.00 0.00 1.3358 0.0000 4942358.67 4942358.67 0.00 91848.33 91848.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.26 52.77% 85821.67 84452 92897 85826.61 84452 88452 1824178 1824178 0.00
hit (blocked) 1.72 4.27% 85800.14 84452 92897 70937.41 0 92897 147704 147704 0.00
crit 16.01 39.76% 171646.92 168903 185794 171658.23 168903 178756 2748835 2748835 0.00
crit (blocked) 1.29 3.21% 171639.59 168903 185794 124392.12 0 185794 221642 221642 0.00
 
 

Action details: felblade

Static Values
  • id:232893
  • school:physical
  • resource:none
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pain<=70
Spelldata
  • id:232893
  • name:Felblade
  • school:physical
  • tooltip:
  • description:Charge to your target and deal $213243sw2 Fire damage. {$?s203513=false}[Shear has a chance to reset the cooldown of Felblade. |cFFFFFFFFGenerates ${{$213243s3=200}/10} Pain.|r][Demon's Bite has a chance to reset the cooldown of Felblade. |cFFFFFFFFGenerates {$213243s4=30} Fury.|r]
 
Fiery Brand 5633 2.8% 7.1 60.61sec 318257 0 Direct 7.1 223227 446453 318263 42.6% 0.0% 0.0%  

Stats details: fiery_brand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.09 7.09 6.97 0.00 0.0000 8.0000 2254948.06 2254948.06 0.00 40468.55 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.07 57.43% 223226.60 223227 223227 222400.58 0 223227 908311 908311 0.00
crit 3.02 42.57% 446453.19 446453 446453 437121.39 0 446453 1346637 1346637 0.00
 
 

Action details: fiery_brand

Static Values
  • id:204021
  • school:fire
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.demon_spikes.down&buff.metamorphosis.down
Spelldata
  • id:204021
  • name:Fiery Brand
  • school:fire
  • tooltip:Dealing {$s1=40}% less damage to the branding Demon Hunter.
  • description:Brand an enemy with a demonic symbol, instantly dealing $sw2 Fire damage and reducing the damage they do to you by {$s1=40}% for {$207744d=8 seconds}.
 
Immolation Aura 75049 36.3% 29.2 13.92sec 1020429 845511 Direct 696.9 29894 59783 42720 42.9% 0.0% 0.0%  

Stats details: immolation_aura

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.18 696.92 0.00 0.00 1.2069 0.0000 29772977.45 29772977.45 0.00 845510.96 845510.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 397.84 57.09% 29893.70 20152 95321 29905.39 25892 34830 11893019 11893019 0.00
crit 299.08 42.91% 59782.67 40305 190642 59808.66 50652 70299 17879958 17879958 0.00
 
 

Action details: immolation_aura

Static Values
  • id:178740
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pain<=80
Spelldata
  • id:178740
  • name:Immolation Aura
  • school:fire
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
 
Infernal Strike 25982 12.6% 21.3 20.10sec 483682 0 Direct 71.6 100871 201746 143977 42.7% 0.0% 0.0%  

Stats details: infernal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.31 71.59 0.00 0.00 0.0000 0.0000 10307173.00 10307173.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.00 57.27% 100870.61 99833 109817 100878.83 99833 102905 4135383 4135383 0.00
crit 30.59 42.73% 201746.31 199667 219633 201762.18 199667 207023 6171790 6171790 0.00
 
 

Action details: infernal_strike

Static Values
  • id:189110
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
Spelldata
  • id:189110
  • name:Infernal Strike
  • school:physical
  • tooltip:
  • description:Leap through the air toward a targeted location, dealing {$189112s1=1} Fire damage to all enemies within $189112a1 yards.
 
Shear 32916 16.1% 156.5 2.54sec 84315 63007 Direct 156.5 59021 118025 84316 42.9% 0.0% 7.5%  

Stats details: shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.49 156.49 0.00 0.00 1.3382 0.0000 13194586.17 19845704.06 33.51 63007.18 63007.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.70 52.84% 60380.31 60380 60380 60380.31 60380 60380 4993196 7340471 31.98
hit (blocked) 6.71 4.29% 42266.21 42266 42266 42232.40 0 42266 283614 595627 52.34
crit 62.02 39.63% 120760.61 120761 120761 120760.61 120761 120761 7489670 11010525 31.98
crit (blocked) 5.06 3.24% 84532.43 84532 84532 83991.37 0 84532 428107 899082 52.05
 
 

Action details: shear

Static Values
  • id:203782
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203782
  • name:Shear
  • school:physical
  • tooltip:
  • description:Shears an enemy for $sw2 Physical damage, and has a small chance to shatter a Lesser Soul Fragment from your target that heals you for {$203794s1=0} health when consumed. |cFFFFFFFFGenerates ${$m3/10} Pain.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
Sigil of Flame 11289 5.5% 13.3 31.01sec 337167 280844 Direct 35.0 52733 105470 75319 42.8% 0.0% 0.0%  
Periodic 69.4 18707 37413 26732 42.9% 0.0% 0.0% 34.6%

Stats details: sigil_of_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.33 35.03 69.42 69.42 1.2006 2.0000 4494340.83 4494340.83 0.00 29024.96 280843.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.03 57.18% 52733.45 51156 56272 52651.41 51156 55091 1056289 1056289 0.00
crit 15.00 42.82% 105469.88 102312 112543 105302.78 102312 111407 1582275 1582275 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.6 57.10% 18707.16 18602 20462 18702.20 18602 19171 741499 741499 0.00
crit 29.8 42.90% 37412.88 37204 40925 37403.22 37204 38445 1114277 1114277 0.00
 
 

Action details: sigil_of_flame

Static Values
  • id:204596
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains-delay<=0.3*duration
Spelldata
  • id:204596
  • name:Sigil of Flame
  • school:physical
  • tooltip:Sigil of Flame is active.
  • description:Place a Sigil of Flame at the target location that activates after {$d=2 seconds}. Deals {$204598s1=0} Fire damage, and an additional $204598o2 Fire damage over {$204598d=6 seconds}, to all enemies affected by the sigil.
 
Soul Carver 9396 4.6% 7.1 60.64sec 531386 381878 Direct 14.2 109684 219593 156512 42.6% 0.0% 7.4%  
Periodic 21.1 51157 102315 73153 43.0% 0.0% 0.0% 5.3%

Stats details: soul_carver

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.08 14.15 21.13 21.13 1.3916 1.0000 3760355.87 3760355.87 0.00 121411.46 381878.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.52 53.11% 109787.43 73153 146307 109777.39 0 146307 825245 825245 0.00
hit (blocked) 0.61 4.28% 108401.29 73153 146307 50078.85 0 146307 65632 65632 0.00
crit 5.58 39.44% 219559.66 146307 292613 219303.33 0 292613 1225441 1225441 0.00
crit (blocked) 0.45 3.17% 220014.51 146307 292613 81047.88 0 292613 98708 98708 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.0 57.01% 51157.42 51157 51157 51157.42 51157 51157 616094 616094 0.00
crit 9.1 42.99% 102314.85 102315 102315 102304.61 0 102315 929235 929235 0.00
 
 

Action details: soul_carver

Static Values
  • id:207407
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.fiery_brand.ticking
Spelldata
  • id:207407
  • name:Soul Carver
  • school:fire
  • tooltip:Suffering {$s1=1} Fire damage every $t sec.
  • description:Carve into the soul of your target, dealing ${$sw2+$214743sw1} Fire damage and an additional ${3*{$s1=1}} Fire damage over {$d=3 seconds}. Immediately shatters {$s4=2} Lesser Soul Fragments from the target and 1 additional Lesser Soul Fragment every $t sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.350000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.41
 
Soul Cleave 18653 9.1% 44.4 8.99sec 168568 125114 Direct 44.4 117958 235886 168568 42.9% 0.0% 7.5%  

Stats details: soul_cleave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.37 44.37 0.00 0.00 1.3473 0.0000 7479719.09 11249745.67 33.51 125114.48 125114.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.43 52.80% 120676.45 61120 121869 120664.44 113636 121869 2827044 4156022 31.98
hit (blocked) 1.90 4.29% 84480.34 42884 85308 72499.64 0 85308 160750 337598 44.94
crit 17.61 39.69% 241334.24 122677 243737 241314.73 218615 243737 4249765 6247556 31.98
crit (blocked) 1.43 3.23% 168935.71 86048 170616 129407.91 0 170616 242160 508569 40.14
 
 

Action details: soul_cleave

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_fragments=5
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=25} yds.
 
Simple Action Stats Execute Interval
Illistan
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
Consume Soul (_lesser) 64.4 6.14sec

Stats details: consume_soul_lesser

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 64.35 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_soul_lesser

Static Values
  • id:203794
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
Spelldata
  • id:203794
  • name:Consume Soul
  • school:shadow
  • tooltip:
  • description:Consume a Lesser Soul Fragment, healing you for {$s1=0} health.
 
Demon Spikes 36.1 11.17sec

Stats details: demon_spikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.11 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demon_spikes

Static Values
  • id:203720
  • school:physical
  • resource:pain
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
Spelldata
  • id:203720
  • name:Demon Spikes
  • school:physical
  • tooltip:
  • description:Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=20}% for {$203819d=6 seconds}.
 
Empower Wards 11.3 36.89sec

Stats details: empower_wards

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.27 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_wards

Static Values
  • id:218256
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.casting.up
Spelldata
  • id:218256
  • name:Empower Wards
  • school:fire
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Cleave (_heal) 44.4 8.99sec

Stats details: soul_cleave_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 44.37 0.00 131.78 0.00 0.0000 1.9971 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_cleave_heal

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=25} yds.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.1 8.8 28.5sec 17.2sec 45.12% 45.12% 8.8(8.8) 13.7

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 13.28% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Defensive Spikes 36.1 0.0 11.2sec 11.2sec 26.95% 25.73% 0.0(0.0) 35.8

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_defensive_spikes
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10

Stack Uptimes

  • defensive_spikes_1:26.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212871
  • name:Defensive Spikes
  • tooltip:
  • description:{$@spelldesc212829=Increases your chance to parry by an additional {$212871s1=10}% for the first {$212871d=3 seconds} after activating Demon Spikes.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Demon Spikes 36.1 0.0 11.2sec 11.2sec 53.71% 53.53% 0.0(0.0) 35.6

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_demon_spikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • demon_spikes_1:53.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203819
  • name:Demon Spikes
  • tooltip:Parry chance increased by $w1%. Physical damage taken reduced by ${-$W2}.2%.
  • description:{$@spelldesc203720=Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=20}% for {$203819d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Empower Wards 11.3 0.0 36.9sec 36.9sec 16.76% 17.88% 0.0(0.0) 11.1

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_empower_wards
  • max_stacks:1
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.30

Stack Uptimes

  • empower_wards_1:16.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218256
  • name:Empower Wards
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
Immolation Aura 29.2 0.0 13.9sec 13.9sec 43.37% 39.99% 173.6(173.6) 28.8

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_immolation_aura
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • immolation_aura_1:43.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:178740
  • name:Immolation Aura
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
  • max_stacks:0
  • duration:6.00
  • cooldown:15.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 9.76% 9.76% 2.0(2.0) 0.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:9.76%

Trigger Attempt Success

  • trigger_pct:100.00%
Unbending Potion 1.0 0.0 0.0sec 0.0sec 5.82% 5.82% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_unbending_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3500.00

Stack Uptimes

  • unbending_potion_1:5.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188029
  • name:Unbending Potion
  • tooltip:Armor increased by {$s1=3500}.
  • description:Increases your Armor by {$s1=3500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Illistan
demon_spikes Pain 36.1 722.2 20.0 20.0 0.0
soul_cleave Pain 44.4 2636.2 59.4 59.4 2837.3
Resource Gains Type Count Total Average Overflow
damage_taken Pain 255.59 460.93 (13.51%) 1.80 0.04 0.01%
immolation_aura Pain 29.18 233.41 (6.84%) 8.00 0.00 0.00%
immolation_aura_tick Pain 173.59 347.10 (10.17%) 2.00 0.07 0.02%
felblade_dmg Pain 40.28 805.65 (23.61%) 20.00 0.00 0.00%
shear Pain 156.49 1564.91 (45.86%) 10.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 60859.55 61412.74
Pain 8.51 8.38
Combat End Resource Mean Min Max
Pain 53.81 0.00 99.45

Benefits & Uptimes

Benefits %
Uptimes %
Pain Cap 0.0%

Procs

Count Interval
parry_haste 32.2 12.2sec
soul_fragment_lesser 74.1 6.0sec
felblade_reset 25.2 15.8sec
soul_fragment_overflow 2.0 101.6sec

Statistics & Data Analysis

Fight Length
Sample Data Illistan Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Illistan Damage Per Second
Count 9999
Mean 205587.86
Minimum 176402.17
Maximum 241995.65
Spread ( max - min ) 65593.48
Range [ ( max - min ) / 2 * 100% ] 15.95%
Standard Deviation 10787.3003
5th Percentile 189699.31
95th Percentile 224647.56
( 95th Percentile - 5th Percentile ) 34948.24
Mean Distribution
Standard Deviation 107.8784
95.00% Confidence Intervall ( 205376.42 - 205799.30 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10576
0.1 Scale Factor Error with Delta=300 993365
0.05 Scale Factor Error with Delta=300 3973463
0.01 Scale Factor Error with Delta=300 99336580
Priority Target DPS
Sample Data Illistan Priority Target Damage Per Second
Count 9999
Mean 128916.96
Minimum 120249.03
Maximum 138867.80
Spread ( max - min ) 18618.77
Range [ ( max - min ) / 2 * 100% ] 7.22%
Standard Deviation 2378.0487
5th Percentile 125096.66
95th Percentile 132845.72
( 95th Percentile - 5th Percentile ) 7749.06
Mean Distribution
Standard Deviation 23.7817
95.00% Confidence Intervall ( 128870.35 - 128963.57 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1307
0.1 Scale Factor Error with Delta=300 48275
0.05 Scale Factor Error with Delta=300 193101
0.01 Scale Factor Error with Delta=300 4827532
DPS(e)
Sample Data Illistan Damage Per Second (Effective)
Count 9999
Mean 205587.86
Minimum 176402.17
Maximum 241995.65
Spread ( max - min ) 65593.48
Range [ ( max - min ) / 2 * 100% ] 15.95%
Damage
Sample Data Illistan Damage
Count 9999
Mean 81956306.82
Minimum 65795318.19
Maximum 98104927.11
Spread ( max - min ) 32309608.92
Range [ ( max - min ) / 2 * 100% ] 19.71%
DTPS
Sample Data Illistan Damage Taken Per Second
Count 9999
Mean 61387.56
Minimum 46173.32
Maximum 69189.72
Spread ( max - min ) 23016.40
Range [ ( max - min ) / 2 * 100% ] 18.75%
Standard Deviation 2084.4316
5th Percentile 57961.57
95th Percentile 64716.03
( 95th Percentile - 5th Percentile ) 6754.46
Mean Distribution
Standard Deviation 20.8454
95.00% Confidence Intervall ( 61346.71 - 61428.42 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4429
0.1 Scale Factor Error with Delta=300 37090
0.05 Scale Factor Error with Delta=300 148360
0.01 Scale Factor Error with Delta=300 3709018
HPS
Sample Data Illistan Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Illistan Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Illistan Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Illistan Healing Taken Per Second
Count 9999
Mean 60828.25
Minimum 45646.88
Maximum 68756.46
Spread ( max - min ) 23109.58
Range [ ( max - min ) / 2 * 100% ] 19.00%
TMI
Sample Data Illistan Theck-Meloree Index
Count 9999
Mean 61576.86
Minimum 59112.83
Maximum 64035.89
Spread ( max - min ) 4923.06
Range [ ( max - min ) / 2 * 100% ] 4.00%
Standard Deviation 620.3244
5th Percentile 60564.31
95th Percentile 62596.87
( 95th Percentile - 5th Percentile ) 2032.56
Mean Distribution
Standard Deviation 6.2036
95.00% Confidence Intervall ( 61564.70 - 61589.02 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 3
0.1% Error 389
0.1 Scale Factor Error with Delta=300 3284
0.05 Scale Factor Error with Delta=300 13139
0.01 Scale Factor Error with Delta=300 328489
ETMI
Sample Data IllistanTheck-Meloree Index (Effective)
Count 9999
Mean 63937.05
Minimum 62682.81
Maximum 65701.55
Spread ( max - min ) 3018.74
Range [ ( max - min ) / 2 * 100% ] 2.36%
Standard Deviation 359.9099
5th Percentile 63372.02
95th Percentile 64558.32
( 95th Percentile - 5th Percentile ) 1186.29
Mean Distribution
Standard Deviation 3.5993
95.00% Confidence Intervall ( 63929.99 - 63944.10 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1
0.1% Error 121
0.1 Scale Factor Error with Delta=300 1105
0.05 Scale Factor Error with Delta=300 4423
0.01 Scale Factor Error with Delta=300 110578
MSD
Sample Data Illistan Max Spike Value
Count 2504
Mean 20.55
Minimum 13.94
Maximum 31.01
Spread ( max - min ) 17.08
Range [ ( max - min ) / 2 * 100% ] 41.54%
Standard Deviation 2.5660
5th Percentile 16.79
95th Percentile 25.12
( 95th Percentile - 5th Percentile ) 8.32
Mean Distribution
Standard Deviation 0.0513
95.00% Confidence Intervall ( 20.45 - 20.65 )
Normalized 95.00% Confidence Intervall ( 99.51% - 100.49% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 598
0.1% Error 59879
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 5

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=unbending_potion
Default action list Executed every time the actor is available.
# count action,conditions
5 33.67 auto_attack
6 7.33 fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
7 36.15 demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
8 11.27 empower_wards,if=debuff.casting.up
9 7.39 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
A 15.16 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
0.00 spirit_bomb,if=debuff.frailty.down
B 7.08 soul_carver,if=dot.fiery_brand.ticking
C 29.30 immolation_aura,if=pain<=80
D 40.33 felblade,if=pain<=70
0.00 soul_barrier
E 7.00 soul_cleave,if=soul_fragments=5
0.00 metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
0.00 fel_devastation,if=incoming_damage_5s>health.max*0.70
0.00 soul_cleave,if=incoming_damage_5s>=health.max*0.70
0.00 fel_eruption
F 13.34 sigil_of_flame,if=remains-delay<=0.3*duration
0.00 fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
G 37.38 soul_cleave,if=pain>=80
H 156.49 shear

Sample Sequence

0124569B9C8D7FHHEHD7HHHC5HH7HHGDH7A5HHCHGHH7HD5HGHCFHH7HHGAD8HDG5CH7HH5HHGDH695BCEDFH7HHHHG7C5H8DHA5HG7HHHDCH5GH7HFHHHAGCDH7D5G5H8HHC7HHGD5H69BFHEC7HHHDHA5GH7HHCHHHG8DH7D5HFGCHAHHG7HD5HHCHG7HHHDH69BGC85FHH7DEHDAA5H7HC5HGHHHD7HGDCHH5FGHD78AHDGC5HHH5G7HHHDH69BC8EDF5H7HHHGHA5C7DHHGD5HHHG7CHHHHFH5G7ADH8C5HHGD7H5HHG69BCHEDF7HH5HDAHCG7HHHHH8HG57DCHDGHHFHH7H5ACGDHHGHHH7HCH5H69BGDE8HD7FCHHA5H7HHHGDHCHG7HH5HHHHGCD7FHDG8

Sample Sequence Table

time name target resources buffs
Pre flask Illistan 0.0/100: 0% pain
Pre food Illistan 0.0/100: 0% pain
Pre augmentation Illistan 0.0/100: 0% pain
Pre potion Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 fiery_brand Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 infernal_strike Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 soul_carver Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:01.432 infernal_strike Fluffy_Pillow 0.0/100: 0% pain bloodlust, blood_frenzy, unbending_potion
0:01.432 immolation_aura Fluffy_Pillow 0.0/100: 0% pain bloodlust, blood_frenzy, unbending_potion
0:02.032 empower_wards Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:02.186 felblade Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:02.186 demon_spikes Fluffy_Pillow 8.0/100: 8% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:03.206 sigil_of_flame Fluffy_Pillow 10.0/100: 10% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:03.961 shear Fluffy_Pillow 12.0/100: 12% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:04.982 shear Fluffy_Pillow 24.0/100: 24% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:06.002 soul_cleave Fluffy_Pillow 37.2/100: 37% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:07.020 shear Fluffy_Pillow 3.4/100: 3% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:08.040 felblade Fluffy_Pillow 15.4/100: 15% pain bloodlust, demon_spikes, blood_frenzy, unbending_potion
0:08.240 demon_spikes Fluffy_Pillow 15.4/100: 15% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:09.059 shear Fluffy_Pillow 16.4/100: 16% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:10.079 shear Fluffy_Pillow 28.1/100: 28% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:11.180 shear Fluffy_Pillow 39.1/100: 39% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:12.283 immolation_aura Fluffy_Pillow 50.8/100: 51% pain bloodlust, raid_movement, demon_spikes, unbending_potion
0:13.089 auto_attack Fluffy_Pillow 59.7/100: 60% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:13.089 shear Fluffy_Pillow 59.7/100: 60% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:14.190 shear Fluffy_Pillow 71.7/100: 72% pain bloodlust, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:14.290 demon_spikes Fluffy_Pillow 63.7/100: 64% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:15.211 shear Fluffy_Pillow 64.7/100: 65% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:16.230 shear Fluffy_Pillow 78.2/100: 78% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:17.251 soul_cleave Fluffy_Pillow 91.1/100: 91% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:18.271 felblade Fluffy_Pillow 34.8/100: 35% pain bloodlust, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:19.452 shear Fluffy_Pillow 57.8/100: 58% pain bloodlust, demon_spikes, blood_frenzy, unbending_potion
0:20.352 demon_spikes Fluffy_Pillow 49.4/100: 49% pain bloodlust, raid_movement, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:20.472 infernal_strike Fluffy_Pillow 49.4/100: 49% pain bloodlust, raid_movement, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:20.472 auto_attack Fluffy_Pillow 49.4/100: 49% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:20.472 shear Fluffy_Pillow 49.4/100: 49% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:21.495 shear Fluffy_Pillow 60.4/100: 60% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:22.514 immolation_aura Fluffy_Pillow 70.4/100: 70% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:23.284 shear Fluffy_Pillow 79.4/100: 79% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:24.386 soul_cleave Fluffy_Pillow 93.2/100: 93% pain bloodlust, demon_spikes, immolation_aura
0:25.487 shear Fluffy_Pillow 35.2/100: 35% pain bloodlust, demon_spikes, immolation_aura
0:26.589 shear Fluffy_Pillow 49.2/100: 49% pain bloodlust, immolation_aura
0:27.043 demon_spikes Fluffy_Pillow 39.2/100: 39% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:27.691 shear Fluffy_Pillow 41.2/100: 41% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:28.793 felblade Fluffy_Pillow 53.2/100: 53% pain bloodlust, raid_movement, defensive_spikes, demon_spikes
0:30.138 auto_attack Fluffy_Pillow 75.1/100: 75% pain bloodlust, demon_spikes
0:30.138 shear Fluffy_Pillow 75.1/100: 75% pain bloodlust, demon_spikes
0:31.242 soul_cleave Fluffy_Pillow 85.1/100: 85% pain bloodlust, demon_spikes
0:32.345 shear Fluffy_Pillow 27.0/100: 27% pain bloodlust, demon_spikes, blood_frenzy
0:33.365 immolation_aura Fluffy_Pillow 37.0/100: 37% pain bloodlust, blood_frenzy
0:34.120 sigil_of_flame Fluffy_Pillow 48.1/100: 48% pain bloodlust, immolation_aura, blood_frenzy
0:34.875 shear Fluffy_Pillow 50.1/100: 50% pain bloodlust, immolation_aura, blood_frenzy
0:35.896 shear Fluffy_Pillow 62.1/100: 62% pain bloodlust, immolation_aura, blood_frenzy
0:36.651 demon_spikes Fluffy_Pillow 60.7/100: 61% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:36.918 shear Fluffy_Pillow 60.7/100: 61% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:37.940 shear Fluffy_Pillow 72.7/100: 73% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:38.961 soul_cleave Fluffy_Pillow 86.9/100: 87% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:39.980 infernal_strike Fluffy_Pillow 28.9/100: 29% pain bloodlust, demon_spikes, blood_frenzy
0:40.001 felblade Fluffy_Pillow 28.9/100: 29% pain bloodlust, demon_spikes, blood_frenzy
0:40.101 empower_wards Fluffy_Pillow 48.9/100: 49% pain bloodlust, demon_spikes, empower_wards, blood_frenzy
0:41.023 shear Fluffy_Pillow 48.9/100: 49% pain demon_spikes, empower_wards, blood_frenzy
0:42.349 felblade Fluffy_Pillow 60.3/100: 60% pain demon_spikes, empower_wards
0:43.780 soul_cleave Fluffy_Pillow 80.3/100: 80% pain empower_wards
0:45.211 auto_attack Fluffy_Pillow 23.6/100: 24% pain empower_wards
0:45.211 immolation_aura Fluffy_Pillow 23.6/100: 24% pain empower_wards
0:46.572 shear Fluffy_Pillow 37.2/100: 37% pain immolation_aura
0:47.676 demon_spikes Fluffy_Pillow 29.2/100: 29% pain defensive_spikes, demon_spikes, immolation_aura
0:48.004 shear Fluffy_Pillow 29.2/100: 29% pain defensive_spikes, demon_spikes, immolation_aura
0:49.435 shear Fluffy_Pillow 44.1/100: 44% pain defensive_spikes, demon_spikes, immolation_aura
0:50.865 Waiting 2.400 sec 59.2/100: 59% pain raid_movement, demon_spikes, immolation_aura
0:53.265 auto_attack Fluffy_Pillow 64.3/100: 64% pain demon_spikes
0:53.265 shear Fluffy_Pillow 64.3/100: 64% pain demon_spikes
0:54.697 shear Fluffy_Pillow 78.6/100: 79% pain
0:56.128 soul_cleave Fluffy_Pillow 92.7/100: 93% pain
0:57.560 felblade Fluffy_Pillow 32.7/100: 33% pain
0:58.991 shear Fluffy_Pillow 56.9/100: 57% pain
1:00.423 fiery_brand Fluffy_Pillow 67.8/100: 68% pain raid_movement
1:00.423 infernal_strike Fluffy_Pillow 67.8/100: 68% pain raid_movement
1:00.423 auto_attack Fluffy_Pillow 67.8/100: 68% pain
1:00.423 soul_carver Fluffy_Pillow 67.8/100: 68% pain
1:01.854 immolation_aura Fluffy_Pillow 67.8/100: 68% pain
1:03.215 soul_cleave Fluffy_Pillow 80.4/100: 80% pain immolation_aura
1:04.648 felblade Fluffy_Pillow 24.8/100: 25% pain immolation_aura
1:06.079 sigil_of_flame Fluffy_Pillow 52.9/100: 53% pain immolation_aura
1:07.441 shear Fluffy_Pillow 54.9/100: 55% pain immolation_aura
1:08.441 demon_spikes Fluffy_Pillow 48.8/100: 49% pain defensive_spikes, demon_spikes, blood_frenzy
1:08.873 shear Fluffy_Pillow 48.8/100: 49% pain defensive_spikes, demon_spikes, blood_frenzy
1:10.198 shear Fluffy_Pillow 58.8/100: 59% pain defensive_spikes, demon_spikes, blood_frenzy
1:11.523 shear Fluffy_Pillow 68.8/100: 69% pain demon_spikes, blood_frenzy
1:12.850 shear Fluffy_Pillow 78.8/100: 79% pain demon_spikes, blood_frenzy
1:14.178 soul_cleave Fluffy_Pillow 88.8/100: 89% pain demon_spikes, blood_frenzy
1:14.478 demon_spikes Fluffy_Pillow 8.8/100: 9% pain defensive_spikes, demon_spikes, blood_frenzy
1:15.504 immolation_aura Fluffy_Pillow 8.8/100: 9% pain defensive_spikes, demon_spikes, blood_frenzy
1:16.678 Waiting 0.300 sec 21.0/100: 21% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:16.978 auto_attack Fluffy_Pillow 21.0/100: 21% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:16.978 shear Fluffy_Pillow 21.0/100: 21% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:17.078 empower_wards Fluffy_Pillow 31.0/100: 31% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy
1:18.301 felblade Fluffy_Pillow 35.2/100: 35% pain demon_spikes, empower_wards, immolation_aura
1:19.732 shear Fluffy_Pillow 60.6/100: 61% pain demon_spikes, empower_wards, immolation_aura
1:21.164 infernal_strike Fluffy_Pillow 72.6/100: 73% pain raid_movement, empower_wards, immolation_aura
1:21.164 auto_attack Fluffy_Pillow 72.6/100: 73% pain empower_wards, immolation_aura
1:21.164 shear Fluffy_Pillow 72.6/100: 73% pain empower_wards, immolation_aura
1:22.595 soul_cleave Fluffy_Pillow 84.6/100: 85% pain empower_wards
1:22.595 demon_spikes Fluffy_Pillow 4.6/100: 5% pain defensive_spikes, demon_spikes, empower_wards
1:24.028 shear Fluffy_Pillow 6.6/100: 7% pain defensive_spikes, demon_spikes
1:25.458 shear Fluffy_Pillow 16.6/100: 17% pain defensive_spikes, demon_spikes
1:26.889 shear Fluffy_Pillow 26.6/100: 27% pain demon_spikes
1:28.322 felblade Fluffy_Pillow 39.6/100: 40% pain demon_spikes
1:29.753 immolation_aura Fluffy_Pillow 60.5/100: 61% pain blood_frenzy
1:30.922 shear Fluffy_Pillow 73.4/100: 73% pain immolation_aura, blood_frenzy
1:32.246 Waiting 0.700 sec 86.4/100: 86% pain raid_movement, immolation_aura, blood_frenzy
1:32.946 auto_attack Fluffy_Pillow 88.4/100: 88% pain immolation_aura, blood_frenzy
1:32.946 soul_cleave Fluffy_Pillow 88.4/100: 88% pain immolation_aura, blood_frenzy
1:34.272 shear Fluffy_Pillow 38.0/100: 38% pain immolation_aura, blood_frenzy
1:34.572 demon_spikes Fluffy_Pillow 28.0/100: 28% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:35.598 shear Fluffy_Pillow 31.0/100: 31% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:36.924 sigil_of_flame Fluffy_Pillow 45.1/100: 45% pain defensive_spikes, demon_spikes, blood_frenzy
1:38.093 shear Fluffy_Pillow 48.1/100: 48% pain demon_spikes, blood_frenzy
1:39.417 shear Fluffy_Pillow 59.1/100: 59% pain demon_spikes, blood_frenzy
1:40.744 shear Fluffy_Pillow 71.1/100: 71% pain blood_frenzy
1:42.071 infernal_strike Fluffy_Pillow 85.2/100: 85% pain blood_frenzy
1:42.071 soul_cleave Fluffy_Pillow 85.2/100: 85% pain blood_frenzy
1:43.398 immolation_aura Fluffy_Pillow 26.1/100: 26% pain blood_frenzy
1:44.564 felblade Fluffy_Pillow 39.0/100: 39% pain immolation_aura, blood_frenzy
1:45.889 shear Fluffy_Pillow 62.0/100: 62% pain immolation_aura, blood_frenzy
1:46.785 demon_spikes Fluffy_Pillow 57.4/100: 57% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:47.214 felblade Fluffy_Pillow 57.4/100: 57% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:48.539 Waiting 0.400 sec 83.6/100: 84% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:48.939 auto_attack Fluffy_Pillow 83.6/100: 84% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:48.939 soul_cleave Fluffy_Pillow 83.6/100: 84% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:50.267 Waiting 3.400 sec 27.5/100: 27% pain raid_movement, demon_spikes, blood_frenzy
1:53.667 auto_attack Fluffy_Pillow 27.5/100: 27% pain blood_frenzy
1:53.667 shear Fluffy_Pillow 27.5/100: 27% pain blood_frenzy
1:54.067 empower_wards Fluffy_Pillow 40.6/100: 41% pain empower_wards, blood_frenzy
1:54.994 shear Fluffy_Pillow 40.6/100: 41% pain empower_wards
1:56.425 shear Fluffy_Pillow 55.2/100: 55% pain empower_wards
1:57.857 immolation_aura Fluffy_Pillow 65.2/100: 65% pain empower_wards
1:59.218 demon_spikes Fluffy_Pillow 78.2/100: 78% pain empower_wards, immolation_aura
1:59.365 shear Fluffy_Pillow 58.2/100: 58% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
2:00.796 shear Fluffy_Pillow 70.2/100: 70% pain defensive_spikes, demon_spikes, immolation_aura
2:02.228 soul_cleave Fluffy_Pillow 84.2/100: 84% pain defensive_spikes, demon_spikes, immolation_aura
2:03.659 felblade Fluffy_Pillow 28.8/100: 29% pain demon_spikes, immolation_aura
2:05.092 Waiting 0.100 sec 50.8/100: 51% pain raid_movement, demon_spikes
2:05.192 auto_attack Fluffy_Pillow 50.8/100: 51% pain demon_spikes
2:05.192 shear Fluffy_Pillow 50.8/100: 51% pain demon_spikes
2:05.392 fiery_brand Fluffy_Pillow 60.8/100: 61% pain
2:06.623 infernal_strike Fluffy_Pillow 62.8/100: 63% pain
2:06.623 soul_carver Fluffy_Pillow 62.8/100: 63% pain
2:08.053 sigil_of_flame Fluffy_Pillow 64.8/100: 65% pain
2:09.412 shear Fluffy_Pillow 65.4/100: 65% pain
2:10.843 soul_cleave Fluffy_Pillow 77.8/100: 78% pain
2:12.275 immolation_aura Fluffy_Pillow 20.3/100: 20% pain
2:13.475 demon_spikes Fluffy_Pillow 10.3/100: 10% pain defensive_spikes, demon_spikes, immolation_aura
2:13.639 shear Fluffy_Pillow 10.3/100: 10% pain defensive_spikes, demon_spikes, immolation_aura
2:15.072 shear Fluffy_Pillow 23.3/100: 23% pain defensive_spikes, demon_spikes, immolation_aura
2:16.504 shear Fluffy_Pillow 40.1/100: 40% pain demon_spikes, immolation_aura, blood_frenzy
2:17.828 felblade Fluffy_Pillow 52.1/100: 52% pain demon_spikes, immolation_aura, blood_frenzy
2:19.152 shear Fluffy_Pillow 76.9/100: 77% pain demon_spikes, blood_frenzy
2:20.476 infernal_strike Fluffy_Pillow 87.9/100: 88% pain raid_movement, blood_frenzy
2:20.476 auto_attack Fluffy_Pillow 87.9/100: 88% pain blood_frenzy
2:20.476 soul_cleave Fluffy_Pillow 87.9/100: 88% pain blood_frenzy
2:21.803 shear Fluffy_Pillow 27.9/100: 28% pain blood_frenzy
2:22.343 demon_spikes Fluffy_Pillow 21.8/100: 22% pain defensive_spikes, demon_spikes, blood_frenzy
2:23.129 shear Fluffy_Pillow 21.8/100: 22% pain defensive_spikes, demon_spikes, blood_frenzy
2:24.454 shear Fluffy_Pillow 32.8/100: 33% pain defensive_spikes, demon_spikes, blood_frenzy
2:25.780 immolation_aura Fluffy_Pillow 42.8/100: 43% pain demon_spikes, blood_frenzy
2:27.005 shear Fluffy_Pillow 53.8/100: 54% pain demon_spikes, immolation_aura
2:28.437 shear Fluffy_Pillow 65.8/100: 66% pain immolation_aura
2:29.868 shear Fluffy_Pillow 79.8/100: 80% pain immolation_aura
2:31.300 soul_cleave Fluffy_Pillow 94.8/100: 95% pain immolation_aura
2:32.100 empower_wards Fluffy_Pillow 40.7/100: 41% pain empower_wards
2:32.731 felblade Fluffy_Pillow 40.7/100: 41% pain empower_wards
2:34.161 shear Fluffy_Pillow 65.5/100: 65% pain empower_wards, blood_frenzy
2:35.109 demon_spikes Fluffy_Pillow 55.5/100: 55% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
2:35.488 felblade Fluffy_Pillow 55.5/100: 55% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
2:36.813 Waiting 0.400 sec 77.6/100: 78% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, blood_frenzy
2:37.213 auto_attack Fluffy_Pillow 77.6/100: 78% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
2:37.213 shear Fluffy_Pillow 77.6/100: 78% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
2:38.537 sigil_of_flame Fluffy_Pillow 87.6/100: 88% pain demon_spikes, blood_frenzy
2:39.705 soul_cleave Fluffy_Pillow 87.6/100: 88% pain demon_spikes, blood_frenzy
2:41.029 immolation_aura Fluffy_Pillow 27.6/100: 28% pain demon_spikes, blood_frenzy
2:42.196 shear Fluffy_Pillow 40.8/100: 41% pain immolation_aura, blood_frenzy
2:43.521 infernal_strike Fluffy_Pillow 52.8/100: 53% pain immolation_aura, blood_frenzy
2:43.521 shear Fluffy_Pillow 52.8/100: 53% pain immolation_aura, blood_frenzy
2:44.847 shear Fluffy_Pillow 64.8/100: 65% pain immolation_aura
2:46.278 soul_cleave Fluffy_Pillow 82.1/100: 82% pain immolation_aura
2:46.574 demon_spikes Fluffy_Pillow 2.1/100: 2% pain defensive_spikes, demon_spikes, immolation_aura
2:47.711 shear Fluffy_Pillow 4.1/100: 4% pain defensive_spikes, demon_spikes
2:49.141 felblade Fluffy_Pillow 17.0/100: 17% pain defensive_spikes, demon_spikes, blood_frenzy
2:50.466 Waiting 2.200 sec 37.0/100: 37% pain raid_movement, demon_spikes, blood_frenzy
2:52.666 auto_attack Fluffy_Pillow 38.0/100: 38% pain blood_frenzy
2:52.666 shear Fluffy_Pillow 38.0/100: 38% pain blood_frenzy
2:53.991 shear Fluffy_Pillow 49.0/100: 49% pain blood_frenzy
2:55.317 immolation_aura Fluffy_Pillow 63.3/100: 63% pain blood_frenzy
2:56.485 shear Fluffy_Pillow 76.2/100: 76% pain immolation_aura, blood_frenzy
2:57.812 soul_cleave Fluffy_Pillow 89.2/100: 89% pain immolation_aura, blood_frenzy
2:58.968 demon_spikes Fluffy_Pillow 14.2/100: 14% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
2:59.137 shear Fluffy_Pillow 15.2/100: 15% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:00.463 shear Fluffy_Pillow 29.2/100: 29% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:01.789 shear Fluffy_Pillow 44.4/100: 44% pain defensive_spikes, demon_spikes, blood_frenzy
3:03.114 felblade Fluffy_Pillow 57.4/100: 57% pain demon_spikes, blood_frenzy
3:04.437 shear Fluffy_Pillow 79.4/100: 79% pain demon_spikes, blood_frenzy
3:05.392 fiery_brand Fluffy_Pillow 90.4/100: 90% pain blood_frenzy
3:05.763 infernal_strike Fluffy_Pillow 90.4/100: 90% pain blood_frenzy
3:05.763 soul_carver Fluffy_Pillow 90.4/100: 90% pain blood_frenzy
3:07.089 soul_cleave Fluffy_Pillow 92.9/100: 93% pain blood_frenzy
3:08.416 immolation_aura Fluffy_Pillow 34.7/100: 35% pain raid_movement
3:09.132 empower_wards Fluffy_Pillow 42.7/100: 43% pain empower_wards, immolation_aura
3:09.993 auto_attack Fluffy_Pillow 44.7/100: 45% pain empower_wards, immolation_aura
3:09.993 sigil_of_flame Fluffy_Pillow 44.7/100: 45% pain empower_wards, immolation_aura
3:11.354 shear Fluffy_Pillow 49.4/100: 49% pain empower_wards, immolation_aura
3:12.784 shear Fluffy_Pillow 65.1/100: 65% pain empower_wards, immolation_aura
3:13.484 demon_spikes Fluffy_Pillow 55.1/100: 55% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
3:14.215 felblade Fluffy_Pillow 59.0/100: 59% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
3:15.646 soul_cleave Fluffy_Pillow 81.0/100: 81% pain defensive_spikes, demon_spikes
3:17.077 shear Fluffy_Pillow 21.0/100: 21% pain demon_spikes
3:18.509 felblade Fluffy_Pillow 31.0/100: 31% pain demon_spikes
3:19.940 infernal_strike Fluffy_Pillow 51.0/100: 51% pain
3:20.000 infernal_strike Fluffy_Pillow 54.2/100: 54% pain raid_movement
3:20.000 auto_attack Fluffy_Pillow 54.2/100: 54% pain
3:20.000 shear Fluffy_Pillow 54.2/100: 54% pain
3:21.432 demon_spikes Fluffy_Pillow 64.2/100: 64% pain blood_frenzy
3:21.636 shear Fluffy_Pillow 44.2/100: 44% pain defensive_spikes, demon_spikes, blood_frenzy
3:22.961 immolation_aura Fluffy_Pillow 56.0/100: 56% pain defensive_spikes, demon_spikes, blood_frenzy
3:24.128 Waiting 0.800 sec 68.1/100: 68% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:24.928 auto_attack Fluffy_Pillow 68.1/100: 68% pain demon_spikes, immolation_aura, blood_frenzy
3:24.928 shear Fluffy_Pillow 68.1/100: 68% pain demon_spikes, immolation_aura, blood_frenzy
3:26.254 soul_cleave Fluffy_Pillow 84.0/100: 84% pain demon_spikes, immolation_aura, blood_frenzy
3:27.577 shear Fluffy_Pillow 26.0/100: 26% pain demon_spikes, immolation_aura, blood_frenzy
3:28.903 shear Fluffy_Pillow 38.0/100: 38% pain immolation_aura, blood_frenzy
3:30.229 shear Fluffy_Pillow 58.2/100: 58% pain blood_frenzy
3:31.555 felblade Fluffy_Pillow 68.2/100: 68% pain
3:32.985 demon_spikes Fluffy_Pillow 92.3/100: 92% pain
3:32.996 shear Fluffy_Pillow 72.3/100: 72% pain defensive_spikes, demon_spikes
3:34.427 soul_cleave Fluffy_Pillow 85.3/100: 85% pain defensive_spikes, demon_spikes, blood_frenzy
3:35.753 felblade Fluffy_Pillow 25.3/100: 25% pain defensive_spikes, demon_spikes, blood_frenzy
3:37.080 immolation_aura Fluffy_Pillow 48.3/100: 48% pain demon_spikes, blood_frenzy
3:38.248 shear Fluffy_Pillow 59.3/100: 59% pain demon_spikes, immolation_aura, blood_frenzy
3:39.573 shear Fluffy_Pillow 71.3/100: 71% pain immolation_aura, blood_frenzy
3:40.898 auto_attack Fluffy_Pillow 87.6/100: 88% pain immolation_aura, blood_frenzy
3:40.898 sigil_of_flame Fluffy_Pillow 87.6/100: 88% pain immolation_aura, blood_frenzy
3:42.066 soul_cleave Fluffy_Pillow 92.6/100: 93% pain immolation_aura, blood_frenzy
3:43.390 shear Fluffy_Pillow 37.6/100: 38% pain blood_frenzy
3:44.716 felblade Fluffy_Pillow 51.9/100: 52% pain
3:45.385 demon_spikes Fluffy_Pillow 51.9/100: 52% pain defensive_spikes, demon_spikes
3:46.147 empower_wards Fluffy_Pillow 52.8/100: 53% pain defensive_spikes, demon_spikes
3:46.147 infernal_strike Fluffy_Pillow 52.8/100: 53% pain defensive_spikes, demon_spikes, empower_wards
3:46.147 shear Fluffy_Pillow 52.8/100: 53% pain defensive_spikes, demon_spikes, empower_wards
3:47.579 felblade Fluffy_Pillow 62.8/100: 63% pain defensive_spikes, demon_spikes, empower_wards
3:49.009 soul_cleave Fluffy_Pillow 86.7/100: 87% pain demon_spikes, empower_wards
3:50.441 Waiting 0.100 sec 26.7/100: 27% pain raid_movement, demon_spikes, empower_wards
3:50.541 immolation_aura Fluffy_Pillow 26.7/100: 27% pain raid_movement, demon_spikes, empower_wards
3:52.130 Waiting 0.800 sec 40.0/100: 40% pain raid_movement, empower_wards, immolation_aura
3:52.930 auto_attack Fluffy_Pillow 42.0/100: 42% pain immolation_aura
3:52.930 shear Fluffy_Pillow 42.0/100: 42% pain immolation_aura
3:54.360 shear Fluffy_Pillow 56.9/100: 57% pain immolation_aura
3:55.791 shear Fluffy_Pillow 70.9/100: 71% pain immolation_aura
3:57.223 auto_attack Fluffy_Pillow 86.2/100: 86% pain
3:57.223 soul_cleave Fluffy_Pillow 86.2/100: 86% pain
3:58.655 demon_spikes Fluffy_Pillow 29.2/100: 29% pain
3:58.659 shear Fluffy_Pillow 9.2/100: 9% pain defensive_spikes, demon_spikes
4:00.091 shear Fluffy_Pillow 21.7/100: 22% pain defensive_spikes, demon_spikes
4:01.523 shear Fluffy_Pillow 31.7/100: 32% pain defensive_spikes, demon_spikes
4:02.955 felblade Fluffy_Pillow 43.6/100: 44% pain demon_spikes
4:04.386 shear Fluffy_Pillow 63.6/100: 64% pain demon_spikes
4:05.392 fiery_brand Fluffy_Pillow 73.6/100: 74% pain
4:05.815 infernal_strike Fluffy_Pillow 73.6/100: 74% pain
4:05.815 soul_carver Fluffy_Pillow 73.6/100: 74% pain
4:07.247 immolation_aura Fluffy_Pillow 73.6/100: 74% pain
4:08.147 empower_wards Fluffy_Pillow 83.6/100: 84% pain empower_wards, immolation_aura
4:08.608 soul_cleave Fluffy_Pillow 85.6/100: 86% pain empower_wards, immolation_aura
4:10.040 felblade Fluffy_Pillow 29.2/100: 29% pain empower_wards, immolation_aura
4:11.471 sigil_of_flame Fluffy_Pillow 53.7/100: 54% pain empower_wards, immolation_aura
4:12.788 Waiting 0.100 sec 57.6/100: 58% pain raid_movement, empower_wards, immolation_aura, blood_frenzy
4:12.888 auto_attack Fluffy_Pillow 57.6/100: 58% pain empower_wards, immolation_aura, blood_frenzy
4:12.888 shear Fluffy_Pillow 57.6/100: 58% pain empower_wards, immolation_aura, blood_frenzy
4:13.488 demon_spikes Fluffy_Pillow 50.0/100: 50% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
4:14.212 shear Fluffy_Pillow 50.0/100: 50% pain defensive_spikes, demon_spikes, blood_frenzy
4:15.537 shear Fluffy_Pillow 60.9/100: 61% pain defensive_spikes, demon_spikes, blood_frenzy
4:16.862 shear Fluffy_Pillow 70.9/100: 71% pain demon_spikes, blood_frenzy
4:18.189 soul_cleave Fluffy_Pillow 83.9/100: 84% pain demon_spikes, blood_frenzy
4:19.515 shear Fluffy_Pillow 24.9/100: 25% pain blood_frenzy
4:20.841 infernal_strike Fluffy_Pillow 37.8/100: 38% pain raid_movement, blood_frenzy
4:20.841 auto_attack Fluffy_Pillow 37.8/100: 38% pain blood_frenzy
4:20.841 immolation_aura Fluffy_Pillow 37.8/100: 38% pain blood_frenzy
4:22.009 demon_spikes Fluffy_Pillow 51.6/100: 52% pain immolation_aura, blood_frenzy
4:22.205 felblade Fluffy_Pillow 31.6/100: 32% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
4:23.533 shear Fluffy_Pillow 54.6/100: 55% pain defensive_spikes, demon_spikes, immolation_aura
4:24.964 shear Fluffy_Pillow 68.6/100: 69% pain defensive_spikes, demon_spikes, immolation_aura
4:26.395 soul_cleave Fluffy_Pillow 85.5/100: 86% pain demon_spikes, immolation_aura
4:27.827 felblade Fluffy_Pillow 28.5/100: 28% pain demon_spikes
4:29.257 auto_attack Fluffy_Pillow 51.9/100: 52% pain
4:29.257 shear Fluffy_Pillow 51.9/100: 52% pain
4:30.689 shear Fluffy_Pillow 64.8/100: 65% pain
4:32.120 shear Fluffy_Pillow 77.8/100: 78% pain
4:33.552 soul_cleave Fluffy_Pillow 87.8/100: 88% pain
4:33.552 demon_spikes Fluffy_Pillow 7.8/100: 8% pain defensive_spikes, demon_spikes
4:34.984 immolation_aura Fluffy_Pillow 7.8/100: 8% pain defensive_spikes, demon_spikes
4:36.363 shear Fluffy_Pillow 17.8/100: 18% pain defensive_spikes, demon_spikes, immolation_aura
4:37.797 shear Fluffy_Pillow 29.8/100: 30% pain demon_spikes, immolation_aura
4:39.229 shear Fluffy_Pillow 46.0/100: 46% pain demon_spikes, immolation_aura, blood_frenzy
4:40.553 shear Fluffy_Pillow 60.8/100: 61% pain immolation_aura, blood_frenzy
4:41.879 sigil_of_flame Fluffy_Pillow 72.8/100: 73% pain blood_frenzy
4:43.046 shear Fluffy_Pillow 75.8/100: 76% pain blood_frenzy
4:44.373 Waiting 0.800 sec 89.0/100: 89% pain raid_movement, blood_frenzy
4:45.173 auto_attack Fluffy_Pillow 89.0/100: 89% pain blood_frenzy
4:45.173 soul_cleave Fluffy_Pillow 89.0/100: 89% pain blood_frenzy
4:46.006 demon_spikes Fluffy_Pillow 11.8/100: 12% pain defensive_spikes, demon_spikes, blood_frenzy
4:46.499 infernal_strike Fluffy_Pillow 11.8/100: 12% pain defensive_spikes, demon_spikes, blood_frenzy
4:46.499 felblade Fluffy_Pillow 11.8/100: 12% pain defensive_spikes, demon_spikes, blood_frenzy
4:47.824 shear Fluffy_Pillow 31.8/100: 32% pain defensive_spikes, demon_spikes, blood_frenzy
4:49.124 empower_wards Fluffy_Pillow 43.8/100: 44% pain demon_spikes, empower_wards, blood_frenzy
4:49.150 immolation_aura Fluffy_Pillow 43.8/100: 44% pain demon_spikes, empower_wards, blood_frenzy
4:50.318 Waiting 2.500 sec 55.8/100: 56% pain raid_movement, demon_spikes, empower_wards, immolation_aura, blood_frenzy
4:52.818 auto_attack Fluffy_Pillow 62.7/100: 63% pain empower_wards, immolation_aura, blood_frenzy
4:52.818 shear Fluffy_Pillow 62.7/100: 63% pain empower_wards, immolation_aura, blood_frenzy
4:54.143 shear Fluffy_Pillow 78.7/100: 79% pain empower_wards, immolation_aura
4:55.575 soul_cleave Fluffy_Pillow 92.7/100: 93% pain
4:57.006 felblade Fluffy_Pillow 36.6/100: 37% pain
4:58.438 demon_spikes Fluffy_Pillow 64.2/100: 64% pain
4:58.680 shear Fluffy_Pillow 44.2/100: 44% pain defensive_spikes, demon_spikes
5:00.113 Waiting 1.100 sec 57.4/100: 57% pain raid_movement, defensive_spikes, demon_spikes
5:01.213 auto_attack Fluffy_Pillow 57.4/100: 57% pain defensive_spikes, demon_spikes
5:01.213 shear Fluffy_Pillow 57.4/100: 57% pain defensive_spikes, demon_spikes
5:02.644 shear Fluffy_Pillow 70.5/100: 70% pain demon_spikes
5:04.075 soul_cleave Fluffy_Pillow 82.6/100: 83% pain demon_spikes
5:05.392 fiery_brand Fluffy_Pillow 23.6/100: 24% pain
5:05.507 infernal_strike Fluffy_Pillow 23.6/100: 24% pain
5:05.507 soul_carver Fluffy_Pillow 23.6/100: 24% pain
5:06.936 immolation_aura Fluffy_Pillow 25.9/100: 26% pain
5:08.298 shear Fluffy_Pillow 38.2/100: 38% pain immolation_aura
5:09.729 soul_cleave Fluffy_Pillow 50.2/100: 50% pain immolation_aura
5:11.162 felblade Fluffy_Pillow 4.6/100: 5% pain immolation_aura
5:12.710 sigil_of_flame Fluffy_Pillow 26.6/100: 27% pain immolation_aura
5:13.410 demon_spikes Fluffy_Pillow 8.6/100: 9% pain defensive_spikes, demon_spikes
5:14.072 shear Fluffy_Pillow 10.6/100: 11% pain defensive_spikes, demon_spikes
5:15.504 shear Fluffy_Pillow 20.6/100: 21% pain defensive_spikes, demon_spikes
5:16.936 Waiting 0.300 sec 30.6/100: 31% pain raid_movement, demon_spikes
5:17.236 auto_attack Fluffy_Pillow 30.6/100: 31% pain demon_spikes
5:17.236 shear Fluffy_Pillow 30.6/100: 31% pain demon_spikes
5:18.667 felblade Fluffy_Pillow 40.6/100: 41% pain demon_spikes
5:20.099 infernal_strike Fluffy_Pillow 63.8/100: 64% pain blood_frenzy
5:20.099 shear Fluffy_Pillow 63.8/100: 64% pain blood_frenzy
5:21.424 immolation_aura Fluffy_Pillow 73.8/100: 74% pain blood_frenzy
5:22.592 soul_cleave Fluffy_Pillow 87.0/100: 87% pain immolation_aura, blood_frenzy
5:22.592 demon_spikes Fluffy_Pillow 7.0/100: 7% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
5:23.916 shear Fluffy_Pillow 9.0/100: 9% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
5:25.243 shear Fluffy_Pillow 22.9/100: 23% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
5:26.568 shear Fluffy_Pillow 41.4/100: 41% pain demon_spikes, immolation_aura, blood_frenzy
5:27.895 shear Fluffy_Pillow 53.4/100: 53% pain demon_spikes, blood_frenzy
5:29.221 shear Fluffy_Pillow 65.5/100: 65% pain blood_frenzy
5:30.221 empower_wards Fluffy_Pillow 78.4/100: 78% pain empower_wards
5:30.546 shear Fluffy_Pillow 78.4/100: 78% pain empower_wards
5:31.978 soul_cleave Fluffy_Pillow 88.4/100: 88% pain empower_wards
5:33.411 auto_attack Fluffy_Pillow 32.4/100: 32% pain empower_wards
5:33.411 demon_spikes Fluffy_Pillow 32.4/100: 32% pain empower_wards
5:33.534 felblade Fluffy_Pillow 12.4/100: 12% pain defensive_spikes, demon_spikes, empower_wards
5:34.965 immolation_aura Fluffy_Pillow 34.3/100: 34% pain defensive_spikes, demon_spikes, empower_wards
5:36.392 shear Fluffy_Pillow 45.0/100: 45% pain defensive_spikes, demon_spikes, immolation_aura
5:37.822 felblade Fluffy_Pillow 58.0/100: 58% pain demon_spikes, immolation_aura
5:39.255 soul_cleave Fluffy_Pillow 87.0/100: 87% pain demon_spikes, immolation_aura
5:40.685 shear Fluffy_Pillow 32.1/100: 32% pain immolation_aura
5:42.116 shear Fluffy_Pillow 48.4/100: 48% pain
5:43.548 sigil_of_flame Fluffy_Pillow 59.4/100: 59% pain
5:44.910 shear Fluffy_Pillow 62.8/100: 63% pain
5:46.340 shear Fluffy_Pillow 73.7/100: 74% pain
5:47.774 demon_spikes Fluffy_Pillow 84.7/100: 85% pain
5:47.808 shear Fluffy_Pillow 64.7/100: 65% pain defensive_spikes, demon_spikes
5:49.239 auto_attack Fluffy_Pillow 77.8/100: 78% pain defensive_spikes, demon_spikes
5:49.239 infernal_strike Fluffy_Pillow 77.8/100: 78% pain defensive_spikes, demon_spikes
5:49.239 immolation_aura Fluffy_Pillow 77.8/100: 78% pain defensive_spikes, demon_spikes
5:50.665 soul_cleave Fluffy_Pillow 87.8/100: 88% pain defensive_spikes, demon_spikes, immolation_aura
5:52.098 felblade Fluffy_Pillow 30.7/100: 31% pain demon_spikes, immolation_aura
5:53.529 shear Fluffy_Pillow 54.7/100: 55% pain demon_spikes, immolation_aura, blood_frenzy
5:54.853 shear Fluffy_Pillow 66.7/100: 67% pain immolation_aura, blood_frenzy
5:56.179 soul_cleave Fluffy_Pillow 85.4/100: 85% pain blood_frenzy
5:57.505 shear Fluffy_Pillow 25.4/100: 25% pain blood_frenzy
5:58.832 shear Fluffy_Pillow 38.4/100: 38% pain blood_frenzy
6:00.158 shear Fluffy_Pillow 51.6/100: 52% pain blood_frenzy
6:00.412 demon_spikes Fluffy_Pillow 41.6/100: 42% pain defensive_spikes, demon_spikes, blood_frenzy
6:01.484 shear Fluffy_Pillow 41.6/100: 42% pain defensive_spikes, demon_spikes, blood_frenzy
6:02.808 immolation_aura Fluffy_Pillow 51.6/100: 52% pain defensive_spikes, demon_spikes, blood_frenzy
6:03.974 shear Fluffy_Pillow 61.6/100: 62% pain demon_spikes, immolation_aura, blood_frenzy
6:05.299 auto_attack Fluffy_Pillow 73.6/100: 74% pain demon_spikes, immolation_aura, blood_frenzy
6:05.299 shear Fluffy_Pillow 73.6/100: 74% pain demon_spikes, immolation_aura, blood_frenzy
6:06.499 fiery_brand Fluffy_Pillow 85.6/100: 86% pain immolation_aura, blood_frenzy
6:06.625 infernal_strike Fluffy_Pillow 85.6/100: 86% pain immolation_aura, blood_frenzy
6:06.625 soul_carver Fluffy_Pillow 85.6/100: 86% pain immolation_aura, blood_frenzy
6:07.951 soul_cleave Fluffy_Pillow 89.6/100: 90% pain immolation_aura, blood_frenzy
6:09.275 felblade Fluffy_Pillow 33.3/100: 33% pain blood_frenzy
6:10.600 soul_cleave Fluffy_Pillow 55.0/100: 55% pain blood_frenzy
6:11.200 empower_wards Fluffy_Pillow 0.0/100: 0% pain empower_wards, blood_frenzy
6:11.925 shear Fluffy_Pillow 0.0/100: 0% pain empower_wards, blood_frenzy
6:13.250 felblade Fluffy_Pillow 11.8/100: 12% pain empower_wards
6:14.550 demon_spikes Fluffy_Pillow 14.2/100: 14% pain defensive_spikes, demon_spikes, empower_wards
6:14.681 sigil_of_flame Fluffy_Pillow 14.2/100: 14% pain defensive_spikes, demon_spikes, empower_wards
6:16.043 immolation_aura Fluffy_Pillow 14.2/100: 14% pain defensive_spikes, demon_spikes, empower_wards
6:17.639 shear Fluffy_Pillow 26.3/100: 26% pain demon_spikes, immolation_aura
6:19.071 shear Fluffy_Pillow 41.1/100: 41% pain demon_spikes, immolation_aura
6:20.500 infernal_strike Fluffy_Pillow 57.9/100: 58% pain raid_movement, demon_spikes, immolation_aura
6:20.500 auto_attack Fluffy_Pillow 57.9/100: 58% pain demon_spikes, immolation_aura
6:20.500 shear Fluffy_Pillow 57.9/100: 58% pain demon_spikes, immolation_aura
6:21.837 demon_spikes Fluffy_Pillow 49.9/100: 50% pain defensive_spikes, demon_spikes, immolation_aura
6:21.931 shear Fluffy_Pillow 49.9/100: 50% pain defensive_spikes, demon_spikes, immolation_aura
6:23.360 shear Fluffy_Pillow 62.9/100: 63% pain defensive_spikes, demon_spikes
6:24.790 shear Fluffy_Pillow 78.3/100: 78% pain defensive_spikes, demon_spikes
6:26.221 soul_cleave Fluffy_Pillow 91.2/100: 91% pain demon_spikes
6:27.652 felblade Fluffy_Pillow 31.2/100: 31% pain demon_spikes
6:29.082 shear Fluffy_Pillow 55.0/100: 55% pain
6:30.513 immolation_aura Fluffy_Pillow 69.1/100: 69% pain blood_frenzy
6:31.704 shear Fluffy_Pillow 79.1/100: 79% pain immolation_aura, blood_frenzy
6:33.031 soul_cleave Fluffy_Pillow 92.0/100: 92% pain immolation_aura, blood_frenzy
6:33.832 demon_spikes Fluffy_Pillow 14.0/100: 14% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
6:34.356 shear Fluffy_Pillow 16.0/100: 16% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
6:35.681 shear Fluffy_Pillow 30.0/100: 30% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
6:37.006 auto_attack Fluffy_Pillow 42.0/100: 42% pain demon_spikes, blood_frenzy
6:37.006 shear Fluffy_Pillow 42.0/100: 42% pain demon_spikes, blood_frenzy
6:38.330 shear Fluffy_Pillow 52.0/100: 52% pain demon_spikes, blood_frenzy
6:39.657 shear Fluffy_Pillow 62.0/100: 62% pain demon_spikes, blood_frenzy
6:40.981 shear Fluffy_Pillow 75.0/100: 75% pain
6:42.411 soul_cleave Fluffy_Pillow 87.9/100: 88% pain
6:43.843 immolation_aura Fluffy_Pillow 27.9/100: 28% pain
6:45.380 felblade Fluffy_Pillow 37.9/100: 38% pain immolation_aura
6:46.577 demon_spikes Fluffy_Pillow 43.3/100: 43% pain defensive_spikes, demon_spikes, immolation_aura
6:46.811 sigil_of_flame Fluffy_Pillow 43.3/100: 43% pain defensive_spikes, demon_spikes, immolation_aura
6:48.172 shear Fluffy_Pillow 47.3/100: 47% pain defensive_spikes, demon_spikes, immolation_aura
6:49.604 felblade Fluffy_Pillow 59.3/100: 59% pain demon_spikes, immolation_aura
6:51.036 soul_cleave Fluffy_Pillow 83.3/100: 83% pain demon_spikes
6:51.236 empower_wards Fluffy_Pillow 23.3/100: 23% pain demon_spikes, empower_wards

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 24145 22520 13488 (9544)
Stamina 46683 46683 19893
Intellect 5328 5003 0
Spirit 2 2 0
Health 2913019 2913019 0
Pain 100 100 0
Crit 42.89% 41.82% 9036
Haste 5.09% 5.09% 1655
Damage / Heal Versatility 8.32% 8.32% 3328
Mitigation Versatility 4.16% 4.16% 3328
Attack Power 28522 26603 0
Mastery 13.60% 13.60% 3547
Armor 4492 4492 2042
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 14.52% 13.70% 0
Tank-Parry 15.15% 14.85% 9036
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 856.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 860, stats: { +1201 Sta, +1252 Crit, +653 Haste }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +904 Crit, +400 Haste }
Local Waist Steelgazer Hide Belt
ilevel: 835, stats: { 176 Armor, +846 AgiInt, +1269 Sta, +602 Haste, +324 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Dreadleather Footpads of the Quickblade
ilevel: 850, stats: { 226 Armor, +1459 Sta, +973 AgiInt, +490 Crit, +490 Vers }
Local Wrists Wristwraps of Broken Trust
ilevel: 850, stats: { 144 Armor, +1094 Sta, +729 AgiInt, +445 Mastery, +288 Crit }
Local Hands Dreadleather Gloves of the Quickblade
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +279 Crit, +699 Vers }
Local Finger1 Dingy Suramar Mercantile Signet
ilevel: 865, stats: { +1258 Sta, +1387 Crit, +555 Vers }, enchant: { +150 Vers }
Local Finger2 Ring of Deep Sea Pearls
ilevel: 860, stats: { +1201 Sta, +1198 Mastery, +708 Vers }, enchant: { +150 Vers }
Local Trinket1 An'she's Token of Guile
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }
Local Back Drape of the Mana-Starved
ilevel: 880, stats: { 145 Armor, +1448 Sta, +965 StrAgiInt, +569 Crit, +252 Vers }, enchant: { +200 Agi }
Local Main Hand Aldrachi Warblades
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }, relics: { +39 ilevels, +40 ilevels, +36 ilevels }
Local Off Hand Aldrachi Warblades
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }

Talents

Level
15 Abyssal Strike (Vengeance Demon Hunter) Agonizing Flames (Vengeance Demon Hunter) Razor Spikes (Vengeance Demon Hunter)
30 Feast of Souls (Vengeance Demon Hunter) Fallout (Vengeance Demon Hunter) Burning Alive (Vengeance Demon Hunter)
45 Felblade Flame Crash (Vengeance Demon Hunter) Fel Eruption (Vengeance Demon Hunter)
60 Feed the Demon (Vengeance Demon Hunter) Fracture (Vengeance Demon Hunter) Soul Rending (Vengeance Demon Hunter)
75 Concentrated Sigils (Vengeance Demon Hunter) Sigil of Chains (Vengeance Demon Hunter) Quickened Sigils (Vengeance Demon Hunter)
90 Fel Devastation (Vengeance Demon Hunter) Blade Turning (Vengeance Demon Hunter) Spirit Bomb (Vengeance Demon Hunter)
100 Last Resort (Vengeance Demon Hunter) Nether Bond (Vengeance Demon Hunter) Soul Barrier (Vengeance Demon Hunter)

Profile

demonhunter="Illistan"
origin="https://us.api.battle.net/wow/character/thrall/Illistan/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/238/157220590-avatar.jpg"
level=110
race=blood_elf
role=tank
position=front
professions=enchanting=59/herbalism=339
talents=2111111
artifact=60:0:0:0:0:1096:1:1101:3:1228:1:1229:3:1232:3:1233:3:1234:3:1328:1
spec=vengeance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=unbending_potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
actions+=/demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
actions+=/empower_wards,if=debuff.casting.up
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
actions+=/spirit_bomb,if=debuff.frailty.down
actions+=/soul_carver,if=dot.fiery_brand.ticking
actions+=/immolation_aura,if=pain<=80
actions+=/felblade,if=pain<=70
actions+=/soul_barrier
actions+=/soul_cleave,if=soul_fragments=5
actions+=/metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
actions+=/fel_devastation,if=incoming_damage_5s>health.max*0.70
actions+=/soul_cleave,if=incoming_damage_5s>=health.max*0.70
actions+=/fel_eruption
actions+=/sigil_of_flame,if=remains-delay<=0.3*duration
actions+=/fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
actions+=/soul_cleave,if=pain>=80
actions+=/shear

head=biornskin_hood,id=134196,bonus_id=1727/1527/3337
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1482/3336
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1472
back=drape_of_the_manastarved,id=141543,bonus_id=1492/3337,enchant=200agi
chest=grove_keepers_robe,id=139207,bonus_id=1807/1808/1472
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1807/1472
hands=dreadleather_gloves,id=128886,bonus_id=689/1682/3408/601/669
waist=steelgazer_hide_belt,id=134155,bonus_id=3432/1497/1674
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=dreadleather_footpads,id=128885,bonus_id=689/1679/3408/600/669
finger1=dingy_suramar_mercantile_signet,id=141492,bonus_id=1808/1477/3336,enchant=150vers
finger2=ring_of_deep_sea_pearls,id=141545,bonus_id=1472,enchant=150vers
trinket1=anshes_token_of_guile,id=139113,bonus_id=3397/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1472
main_hand=aldrachi_warblades,id=128832,bonus_id=721,gem_id=141262/137303/142058/0,relic_id=3432:1497:1674/1727:1492:1813/0/0
off_hand=aldrachi_warblades,id=128831

# Gear Summary
# gear_ilvl=855.94
# gear_agility=13488
# gear_stamina=19893
# gear_crit_rating=9036
# gear_haste_rating=1655
# gear_mastery_rating=3547
# gear_versatility_rating=3328
# gear_armor=2042

Buuey

Buuey : 291969 dps, 173099 dps to main target

  • Race: Tauren
  • Class: Druid
  • Spec: Balance
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
291968.6 291968.6 352.1 / 0.121% 67034.6 / 23.0% 82091.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
3.5 3.5 Astral Power 9.79% 38.5 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Buuey/advanced
Talents
  • 15: Starlord (Balance Druid)
  • 30: Displacer Beast
  • 45: Guardian Affinity (Balance Druid)
  • 60: Typhoon
  • 75: Stellar Flare (Balance Druid)
  • 90: Blessing of the Ancients (Balance Druid)
  • 100: Nature's Balance (Balance Druid)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 752
  • jewelcrafting: 722
Scale Factors for Buuey Damage Per Second
Haste Int Vers Crit Mastery
Scale Factors 9.98 8.69 7.27 7.18 3.81
Normalized 1.15 1.00 0.84 0.83 0.44
Scale Deltas 1138 1138 1138 1138 1138
Error 0.44 0.44 0.44 0.44 0.44
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=8.69, CritRating=7.18, HasteRating=9.98, MasteryRating=3.81, Versatility=7.27 )

Scale Factors for other metrics

Scale Factors for Buuey Damage Per Second
Haste Int Vers Crit Mastery
Scale Factors 9.98 8.69 7.27 7.18 3.81
Normalized 1.15 1.00 0.84 0.83 0.44
Scale Deltas 1138 1138 1138 1138 1138
Error 0.44 0.44 0.44 0.44 0.44
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=8.69, CritRating=7.18, HasteRating=9.98, MasteryRating=3.81, Versatility=7.27 )
Scale Factors for Buuey Priority Target Damage Per Second
Haste Int Vers Crit Mastery
Scale Factors 6.01 5.19 4.30 4.27 1.77
Normalized 1.16 1.00 0.83 0.82 0.34
Scale Deltas 1138 1138 1138 1138 1138
Error 0.14 0.14 0.14 0.14 0.14
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=5.19, CritRating=4.27, HasteRating=6.01, MasteryRating=1.77, Versatility=4.30 )
Scale Factors for Buuey Damage Per Second (Effective)
Haste Int Vers Crit Mastery
Scale Factors 9.98 8.69 7.27 7.18 3.81
Normalized 1.15 1.00 0.84 0.83 0.44
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=8.69, CritRating=7.18, HasteRating=9.98, MasteryRating=3.81, Versatility=7.27 )
Scale Factors for Buuey Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for BuueyTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Buuey 291969
Deadly Grace 8130 2.8% 25.9 8.82sec 124205 0 Direct 25.7 105559 215481 124871 17.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.87 25.73 0.00 0.00 0.0000 0.0000 3213043.62 3213043.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.21 82.43% 105558.83 89246 116020 105556.96 97278 113788 2238832 2238832 0.00
crit 4.52 17.57% 215481.06 182061 236680 213705.38 0 236680 974211 974211 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Full Moon 17043 5.9% 7.6 55.58sec 898146 359394 Direct 16.7 345329 706699 408260 17.4%  

Stats details: full_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.59 16.69 0.00 0.00 2.4991 0.0000 6813746.92 5440797.19 -25.23 359393.79 359393.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.78 82.59% 345328.69 112082 672495 347438.42 112082 672495 4759664 3802552 -26.20
crit 2.91 17.41% 706699.17 228648 1371889 681139.39 0 1371889 2054083 1638245 -43.76
 
 

Action details: full_moon

Static Values
  • id:202771
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.9000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
Spelldata
  • id:202771
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and reduced damage to all other nearby enemies, and resets Full Moon to become New Moon. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:18.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Half Moon 7840 2.7% 7.9 53.04sec 395514 240011 Direct 7.9 336248 685946 396976 17.4%  

Stats details: half_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.95 7.92 0.00 0.00 1.6480 0.0000 3143189.22 3143189.22 0.00 240011.39 240011.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.54 82.63% 336247.84 336248 336248 336247.84 336248 336248 2199920 2199920 0.00
crit 1.38 17.37% 685945.59 685946 685946 531729.60 0 685946 943270 943270 0.00
 
 

Action details: half_moon

Static Values
  • id:202768
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
Spelldata
  • id:202768
  • name:Half Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lunar Strike 60063 20.5% 57.6 6.58sec 413008 205864 Direct 278.0 61637 125659 85602 37.4%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.61 277.95 0.00 0.00 2.0062 0.0000 23793325.20 23793325.20 0.00 205863.79 205863.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.91 62.57% 61637.41 39365 254000 61645.13 53043 72332 10719146 10719146 0.00
crit 104.05 37.43% 125658.53 80304 518159 125660.29 99956 154793 13074180 13074180 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.20
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.stack=3
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 284.0%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.840000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Moonfire 20673 7.1% 18.8 21.99sec 439979 355347 Direct 18.8 50334 102571 59482 17.5%  
Periodic 247.4 24497 49983 28944 17.4% 99.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.82 18.82 247.39 247.39 1.2382 1.6171 8279947.71 8279947.71 0.00 19557.70 355347.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.52 82.49% 50333.65 45208 112801 50372.94 45208 63461 781349 781349 0.00
crit 3.30 17.51% 102570.69 92224 230114 99781.76 0 230114 338035 338035 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 204.2 82.55% 24496.79 1791 56402 24507.86 23548 25874 5002831 5002831 0.00
crit 43.2 17.45% 49983.16 8774 115060 50008.89 46113 60152 2157733 2157733 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=1 + 110.0%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s5487=true}[ Usable while in Bear Form.][]{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
New Moon 4102 1.4% 7.3 55.04sec 224715 171190 Direct 8.3 168124 342974 198400 17.3%  

Stats details: new_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 8.28 0.00 0.00 1.3128 0.0000 1643254.30 1643254.30 0.00 171190.16 171190.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.85 82.69% 168124.48 168124 168124 168124.48 168124 168124 1151415 1151415 0.00
crit 1.43 17.31% 342973.94 342974 342974 269741.68 0 342974 491840 491840 0.00
 
 

Action details: new_moon

Static Values
  • id:202767
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202767
  • name:New Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Solar Wrath 21804 7.7% 70.0 5.67sec 127437 104069 Direct 69.3 108982 222367 128726 17.4%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.99 69.29 0.00 0.00 1.2245 0.0000 8919369.86 8919369.86 0.00 104069.38 104069.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.23 82.59% 108982.40 91087 205707 110502.28 99126 144984 6236633 6236633 0.00
crit 12.06 17.41% 222366.81 185817 419642 225543.82 0 419642 2682737 2682737 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack=3
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=1} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starfall 50738 (59799) 17.2% (20.3%) 15.3 21.78sec 1540135 1270737 Periodic 677.3 25062 51125 29613 17.5% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.35 0.00 0.00 677.33 1.2120 0.0000 20057542.06 20057542.06 0.00 1270736.72 1270736.72
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 559.1 82.54% 25062.07 24776 32209 25060.04 24776 26008 14011496 14011496 0.00
crit 118.3 17.46% 51124.62 50544 65707 51120.29 50544 53814 6046046 6046046 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.oneths_overconfidence.up
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.$?a231049[ Also applies Stellar Empowerment to each target, which increases damage taken from your Moonfire and Sunfire by {$197637s1=20}%.][]
 
    Echoing Stars 9061 3.1% 0.0 0.00sec 0 0 Periodic 635.2 4770 9730 5635 17.4% 0.0%

Stats details: echoing_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 635.17 0.0000 0.0000 3579431.65 3579431.65 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 524.4 82.55% 4769.95 4730 6149 4769.51 4730 4963 2501166 2501166 0.00
crit 110.8 17.45% 9730.45 9649 12544 9729.50 9649 10280 1078265 1078265 0.00
 
 

Action details: echoing_stars

Static Values
  • id:226104
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:226104
  • name:Echoing Stars
  • school:astral
  • tooltip:
  • description:$@spelldesc48505
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.084000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Starsurge 13163 (15363) 4.5% (5.3%) 14.4 27.97sec 427855 347111 Direct 14.4 268663 547736 367433 35.4%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.41 14.37 0.00 0.00 1.2327 0.0000 5281208.38 5281208.38 0.00 347111.02 347111.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.29 64.61% 268663.41 253397 329416 268501.05 253397 310412 2494737 2494737 0.00
crit 5.09 35.39% 547736.46 516930 672009 544991.23 0 672009 2786471 2786471 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=2
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=1} Astral damage. Also grants you Lunar and Solar Empowerments, which increase the damage of your next Lunar Strike and Solar Wrath by {$164547s1=20}%, respectively.$?a231021[ You can accumulate up to {$164547u=1} of each Empowerment.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Goldrinn's Fang 2200 0.8% 4.7 67.44sec 186506 0 Direct 4.7 158414 323195 187171 17.4%  

Stats details: goldrinns_fang

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.74 4.72 0.00 0.00 0.0000 0.0000 883136.31 883136.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.90 82.55% 158413.70 149443 194276 155691.03 0 194276 617046 617046 0.00
crit 0.82 17.45% 323195.48 304864 396323 183454.52 0 396323 266090 266090 0.00
 
 

Action details: goldrinns_fang

Static Values
  • id:203001
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203001
  • name:Goldrinn's Fang
  • school:arcane
  • tooltip:Deals $m1 Arcane damage.
  • description:Deals $m1 Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Stellar Flare 18468 6.4% 14.0 29.54sec 531415 418761 Direct 14.0 76567 156260 90400 17.4%  
Periodic 201.4 25868 52786 30573 17.5% 79.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.96 13.96 201.40 201.40 1.2690 1.5829 7419612.24 7419612.24 0.00 22048.58 418761.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.54 82.65% 76567.31 74723 97139 76551.62 74723 81127 883520 883520 0.00
crit 2.42 17.35% 156259.77 152434 198164 143891.85 0 198164 378594 378594 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 166.2 82.52% 25868.47 700 60597 25876.90 24575 27734 4299357 4299357 0.00
crit 35.2 17.48% 52785.67 1427 123617 52803.85 44190 64724 1858140 1858140 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<4&remains<7.2&astral_power>=15
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=1} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. Stellar Flare benefits from Starfall's Stellar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.650000
  • base_td:1.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Sunfire 46704 15.9% 15.3 23.48sec 1212103 996911 Direct 66.2 49789 101476 58771 17.4%  
Periodic 515.9 24060 49074 28420 17.4% 209.7%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.31 66.17 515.92 515.92 1.2159 1.6291 18551512.17 18551512.17 0.00 21594.58 996910.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.67 82.62% 49789.27 43975 109725 49789.84 43975 65223 2722013 2722013 0.00
crit 11.50 17.38% 101475.86 89709 223838 101484.92 89709 172183 1166790 1166790 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 426.0 82.57% 24060.48 106 54864 24061.11 23022 25727 10249702 10249702 0.00
crit 89.9 17.43% 49074.28 215 111922 49073.98 45319 55998 4413008 4413008 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=1} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Tormenting Cyclone 11979 4.1% 14.0 27.57sec 339238 0 Direct 332.4 12095 24670 14292 17.5%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 332.42 0.00 0.00 0.0000 0.0000 4751023.12 4751023.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 274.35 82.53% 12095.50 11892 15460 12101.00 11892 13499 3318365 3318365 0.00
crit 58.07 17.47% 24670.30 24260 31538 24682.41 24260 28009 1432658 1432658 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Simple Action Stats Execute Interval
Buuey
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
Blessing of Elune 1.0 0.00sec

Stats details: blessing_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blessing_of_elune

Static Values
  • id:202737
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:202737
  • name:Blessing of Elune
  • school:arcane
  • tooltip:Astral Power generated by Solar Wrath and Lunar Strike increased by {$s1=25}%.
  • description:Increases Astral Power generated by Solar Wrath and Lunar Strike by {$s1=25}%.
 
Celestial Alignment 2.5 192.93sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike, Solar Wrath or Stellar Flare instant.][] The act of shapeshifting frees you from movement impairing effects.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 33.29% 0.0(0.0) 1.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.5 0.0 193.1sec 193.1sec 9.04% 9.04% 0.0(0.0) 2.4

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • celestial_alignment_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Lunar Empowerment 12.0 2.5 34.0sec 27.9sec 21.15% 20.33% 2.5(2.5) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_lunar_empowerment
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.23

Stack Uptimes

  • lunar_empowerment_1:21.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Lunar Strike is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Lunar Strike within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Oneth's Intuition 2.9 0.1 74.5sec 69.8sec 7.45% 20.23% 0.1(0.1) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_oneths_intuition
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • oneths_intuition_1:7.45%

Trigger Attempt Success

  • trigger_pct:19.70%

Spelldata details

  • id:209406
  • name:Oneth's Intuition
  • tooltip:Your next Starsurge costs no Astral Power.
  • description:{$@spelldesc209405=Starsurge and Starfall each have a {$s1=20}% chance to make the other free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Oneth's Overconfidence 2.9 0.0 86.8sec 86.8sec 1.01% 17.92% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_oneths_overconfidence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • oneths_overconfidence_1:1.01%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:209407
  • name:Oneth's Overconfidence
  • tooltip:Your next Starfall costs no Astral Power.
  • description:{$@spelldesc209405=Starsurge and Starfall each have a {$s1=20}% chance to make the other free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 189.5sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Solar Empowerment 12.4 2.0 32.7sec 27.9sec 13.20% 19.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_solar_empowerment
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.23

Stack Uptimes

  • solar_empowerment_1:13.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Solar Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Solar Wrath within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of Elune

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_blessing_of_elune
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_elune_1:100.00%

Spelldata details

  • id:202737
  • name:Blessing of Elune
  • tooltip:Astral Power generated by Solar Wrath and Lunar Strike increased by {$s1=25}%.
  • description:Increases Astral Power generated by Solar Wrath and Lunar Strike by {$s1=25}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike, Solar Wrath or Stellar Flare instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Buuey
starfall Astral Power 15.3 748.5 48.8 48.8 31578.0
starsurge Astral Power 14.4 459.1 31.9 31.9 13427.1
stellar_flare Astral Power 14.0 209.4 15.0 15.0 35427.6
Resource Gains Type Count Total Average Overflow
new_moon Astral Power 8.31 83.13 (5.79%) 10.00 0.00 0.00%
half_moon Astral Power 7.95 158.94 (11.07%) 20.00 0.00 0.00%
full_moon Astral Power 7.59 303.45 (21.13%) 40.00 0.00 0.00%
lunar_strike Astral Power 57.61 890.33 (62.01%) 15.45 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 3.58 3.53
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 18.49 0.00 77.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Buuey Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Buuey Damage Per Second
Count 9999
Mean 291968.61
Minimum 245120.42
Maximum 368596.46
Spread ( max - min ) 123476.04
Range [ ( max - min ) / 2 * 100% ] 21.15%
Standard Deviation 17964.5654
5th Percentile 266640.89
95th Percentile 325000.93
( 95th Percentile - 5th Percentile ) 58360.03
Mean Distribution
Standard Deviation 179.6546
95.00% Confidence Intervall ( 291616.49 - 292320.72 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 145
0.1% Error 14543
0.1 Scale Factor Error with Delta=300 2754971
0.05 Scale Factor Error with Delta=300 11019885
0.01 Scale Factor Error with Delta=300 275497141
Priority Target DPS
Sample Data Buuey Priority Target Damage Per Second
Count 9999
Mean 173098.70
Minimum 154224.93
Maximum 195877.11
Spread ( max - min ) 41652.18
Range [ ( max - min ) / 2 * 100% ] 12.03%
Standard Deviation 5595.4102
5th Percentile 164204.87
95th Percentile 182744.13
( 95th Percentile - 5th Percentile ) 18539.26
Mean Distribution
Standard Deviation 55.9569
95.00% Confidence Intervall ( 172989.03 - 173208.38 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4013
0.1 Scale Factor Error with Delta=300 267268
0.05 Scale Factor Error with Delta=300 1069073
0.01 Scale Factor Error with Delta=300 26726834
DPS(e)
Sample Data Buuey Damage Per Second (Effective)
Count 9999
Mean 291968.61
Minimum 245120.42
Maximum 368596.46
Spread ( max - min ) 123476.04
Range [ ( max - min ) / 2 * 100% ] 21.15%
Damage
Sample Data Buuey Damage
Count 9999
Mean 116329342.75
Minimum 95654347.02
Maximum 143736531.04
Spread ( max - min ) 48082184.02
Range [ ( max - min ) / 2 * 100% ] 20.67%
DTPS
Sample Data Buuey Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Buuey Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Buuey Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Buuey Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Buuey Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Buuey Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BuueyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Buuey Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 moonkin_form
4 0.00 blessing_of_elune
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=deadly_grace
7 0.00 new_moon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
0.00 blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
0.00 blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 berserking,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
9 0.00 call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
A 0.00 call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
0.00 new_moon,if=(charges=2&recharge_time<5)|charges=3
0.00 half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
B 0.35 full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
C 15.15 stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
D 18.82 moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
E 15.31 sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
0.00 astral_communion,if=astral_power.deficit>=75
0.00 incarnation,if=astral_power>=40
F 2.47 celestial_alignment,if=astral_power>=40
G 2.87 starfall,if=buff.oneths_overconfidence.up
0.00 solar_wrath,if=buff.solar_empowerment.stack=3
0.00 lunar_strike,if=buff.lunar_empowerment.stack=3
H 0.00 call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
I 0.00 call_action_list,name=single_target
actions.celestial_alignment_phase
# count action,conditions
J 0.45 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
K 2.89 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
L 2.72 solar_wrath,if=buff.solar_empowerment.up
M 2.85 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
N 1.80 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
O 12.90 solar_wrath
actions.single_target
# count action,conditions
P 8.17 new_moon,if=astral_power<=90
Q 9.03 half_moon,if=astral_power<=80
R 10.61 full_moon,if=astral_power<=60
S 12.02 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
T 11.52 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
U 11.13 solar_wrath,if=buff.solar_empowerment.up
V 11.74 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
W 50.57 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
X 52.95 solar_wrath

Sample Sequence

0123467DEQCRFKLMOOOOOOOOOODPWSWWQWWSEWWCDTRTGUVEWWPSDWWWCXXXQEWDSWRWWEWCTGTRDUUVEWWRWSWCDXXRTEUVWWWSPDWWWECTUVQTUVVDWSWERWF8JNCOODOOOPWEWPSWWDWCXXXQXXEWWWDSRWSWWCECPTUVDVWWWEQSWWSXXDRCXEWWWSPWWDWSEXXXQCXXXXXXDXRXXXXXXXXXXRDXXXXXXXXRCTGUVCXDXXPXXXXXXXXCXXQXDXXXXXXXXBFKLM

Sample Sequence Table

time name target resources buffs
Pre flask Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre food Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre augmentation Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre blessing_of_elune Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:01.194 sunfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:02.159 half_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:03.445 stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:04.411 full_moon Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:06.336 celestial_alignment Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:06.336 starsurge Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:07.301 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:08.074 lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:09.360 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:10.325 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:11.290 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:12.254 Waiting 0.900 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, celestial_alignment, potion_of_deadly_grace
0:13.154 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:14.119 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:15.084 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:16.050 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:17.014 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:17.980 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:18.948 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:19.913 moonfire Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:20.879 Waiting 2.700 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, celestial_alignment, potion_of_deadly_grace
0:23.579 new_moon Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust
0:24.545 lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage bloodlust
0:26.152 starfall Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage bloodlust
0:27.120 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:28.084 Waiting 1.100 sec 2.5/100: 3% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, oneths_intuition
0:29.184 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:30.791 half_moon Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:32.076 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:33.682 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:35.288 starfall Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:36.253 sunfire Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:37.220 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:38.827 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:40.433 stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, oneths_intuition
0:41.517 moonfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage oneths_intuition
0:42.770 starsurge Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage oneths_intuition
0:44.024 Waiting 1.200 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
0:45.224 full_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:47.727 starsurge Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:48.980 starfall Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
0:50.234 Waiting 3.400 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
0:53.634 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:54.637 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment
0:56.308 sunfire Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
0:57.562 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
0:59.648 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
1:00.901 Waiting 0.300 sec 52.5/100: 53% astral_power | 0.0/100: 0% rage raid_movement
1:01.201 new_moon Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
1:02.454 starfall Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage
1:03.707 moonfire Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
1:04.961 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
1:07.048 lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:09.134 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:11.222 stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
1:12.475 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:13.729 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:14.984 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:16.237 Waiting 1.000 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
1:17.237 half_moon Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:18.907 sunfire Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
1:20.160 Waiting 3.500 sec 52.5/100: 53% astral_power | 0.0/100: 0% rage raid_movement
1:23.660 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
1:25.748 moonfire Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage
1:27.001 starfall Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage
1:28.257 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage oneths_intuition
1:30.343 full_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage oneths_intuition
1:32.005 Waiting 1.200 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement, oneths_intuition
1:33.205 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage oneths_intuition
1:35.292 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage oneths_intuition
1:37.380 sunfire Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage oneths_intuition
1:38.634 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage oneths_intuition
1:40.723 stellar_flare Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage oneths_intuition
1:41.977 starsurge Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage oneths_intuition
1:43.228 starfall Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
1:44.480 starsurge Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:45.735 full_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:48.005 moonfire Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
1:49.258 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:50.262 Waiting 3.400 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
1:53.662 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:54.665 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
1:56.335 sunfire Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:57.589 lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:59.677 lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
2:01.765 full_moon Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
2:04.004 Waiting 1.200 sec 57.5/100: 57% astral_power | 0.0/100: 0% rage raid_movement
2:05.204 lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
2:07.292 starfall Fluffy_Pillow 72.5/100: 73% astral_power | 0.0/100: 0% rage
2:08.544 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:10.632 stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
2:11.884 moonfire Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:13.136 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:14.390 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:15.644 full_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:18.148 starsurge Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
2:19.401 sunfire Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:20.654 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:21.658 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
2:23.331 lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
2:25.417 lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
2:27.504 lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
2:29.592 starfall Fluffy_Pillow 72.5/100: 73% astral_power | 0.0/100: 0% rage
2:30.846 new_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage oneths_intuition
2:32.099 moonfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage oneths_intuition
2:33.351 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage oneths_intuition
2:35.437 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage oneths_intuition
2:36.690 Waiting 0.500 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage raid_movement, oneths_intuition
2:37.190 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage oneths_intuition
2:39.275 sunfire Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage oneths_intuition
2:40.527 stellar_flare Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage oneths_intuition
2:41.778 starsurge Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage oneths_intuition
2:43.032 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:44.037 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage lunar_empowerment
2:45.706 half_moon Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
2:47.376 starsurge Fluffy_Pillow 72.5/100: 73% astral_power | 0.0/100: 0% rage
2:48.631 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:49.635 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment
2:50.637 Waiting 2.000 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
2:52.637 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment
2:54.305 moonfire Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
2:55.557 lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
2:57.646 starfall Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage
2:58.900 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
3:00.988 sunfire Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
3:02.241 full_moon Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
3:04.745 lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
3:06.832 celestial_alignment Fluffy_Pillow 72.5/100: 73% astral_power | 0.0/100: 0% rage
3:06.832 potion Fluffy_Pillow 72.5/100: 73% astral_power | 0.0/100: 0% rage celestial_alignment
3:06.832 starfall Fluffy_Pillow 72.5/100: 73% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:08.086 Waiting 1.100 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, potion_of_deadly_grace
3:09.186 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:11.273 stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:12.528 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:13.780 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:15.031 moonfire Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:16.284 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:17.538 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:18.792 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:20.045 Waiting 3.600 sec 20.0/100: 20% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, potion_of_deadly_grace
3:23.645 new_moon Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:24.896 Waiting 0.300 sec 20.0/100: 20% astral_power | 0.0/100: 0% rage raid_movement, potion_of_deadly_grace
3:25.196 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:27.284 sunfire Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:28.536 lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:30.623 new_moon Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:31.878 starfall Fluffy_Pillow 60.0/100: 60% astral_power | 0.0/100: 0% rage
3:33.131 lunar_strike Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
3:35.220 lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage
3:37.308 moonfire Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
3:38.562 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
3:40.003 Waiting 1.200 sec 30.0/100: 30% astral_power | 0.0/100: 0% rage raid_movement
3:41.203 stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
3:42.455 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage
3:43.708 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage
3:44.963 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage
3:46.215 half_moon Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage
3:47.884 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
3:49.137 solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
3:50.391 Waiting 1.900 sec 35.0/100: 35% astral_power | 0.0/100: 0% rage raid_movement
3:52.291 sunfire Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage raid_movement
3:53.546 Waiting 0.100 sec 35.0/100: 35% astral_power | 0.0/100: 0% rage raid_movement
3:53.646 lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
3:55.730 lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
3:56.982 Waiting 0.200 sec 50.0/100: 50% astral_power | 0.0/100: 0% rage raid_movement
3:57.182 lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
3:59.270 moonfire Fluffy_Pillow 65.0/100: 65% astral_power | 0.0/100: 0% rage
4:00.524 starfall Fluffy_Pillow 65.0/100: 65% astral_power | 0.0/100: 0% rage
4:01.777 full_moon Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
4:04.280 lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
4:06.367 starfall Fluffy_Pillow 60.0/100: 60% astral_power | 0.0/100: 0% rage
4:07.621 lunar_strike Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage oneths_intuition
4:09.710 lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage oneths_intuition
4:11.799 stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage oneths_intuition
4:13.052 sunfire Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage raid_movement, oneths_intuition
4:14.306 stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage oneths_intuition
4:15.560 new_moon Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage oneths_intuition
4:16.813 starsurge Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage oneths_intuition
4:18.067 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:19.070 lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment
4:20.076 Waiting 1.000 sec 25.0/100: 25% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:21.076 moonfire Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:22.327 Waiting 1.300 sec 25.0/100: 25% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:23.627 lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage lunar_empowerment
4:25.298 lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
4:27.386 lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage
4:28.640 Waiting 0.600 sec 55.0/100: 55% astral_power | 0.0/100: 0% rage raid_movement
4:29.240 lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage
4:31.328 sunfire Fluffy_Pillow 70.0/100: 70% astral_power | 0.0/100: 0% rage
4:32.581 half_moon Fluffy_Pillow 70.0/100: 70% astral_power | 0.0/100: 0% rage
4:34.250 starfall Fluffy_Pillow 90.0/100: 90% astral_power | 0.0/100: 0% rage
4:35.506 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
4:37.594 lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power | 0.0/100: 0% rage
4:39.680 starfall Fluffy_Pillow 60.0/100: 60% astral_power | 0.0/100: 0% rage
4:40.933 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
4:42.188 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
4:43.442 moonfire Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
4:44.696 Waiting 0.500 sec 0.0/100: 0% astral_power | 0.0/100: 0% rage raid_movement
4:45.196 full_moon Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
4:47.699 stellar_flare Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
4:48.953 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
4:50.207 Waiting 2.000 sec 25.0/100: 25% astral_power | 0.0/100: 0% rage raid_movement
4:52.207 sunfire Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage raid_movement
4:53.460 Waiting 0.200 sec 25.0/100: 25% astral_power | 0.0/100: 0% rage raid_movement
4:53.660 lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
4:55.746 lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
4:57.834 lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage
4:59.922 starfall Fluffy_Pillow 70.0/100: 70% astral_power | 0.0/100: 0% rage
5:01.175 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:02.428 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:04.515 lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power | 0.0/100: 0% rage
5:06.603 moonfire Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
5:07.857 lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
5:09.946 starfall Fluffy_Pillow 65.0/100: 65% astral_power | 0.0/100: 0% rage
5:11.199 sunfire Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
5:12.452 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
5:13.706 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
5:14.959 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
5:16.211 Waiting 1.000 sec 5.0/100: 5% astral_power | 0.0/100: 0% rage raid_movement
5:17.211 half_moon Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
5:18.883 stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
5:20.137 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:21.390 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:22.644 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:23.898 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:25.152 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:26.406 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:27.660 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:28.913 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:30.167 full_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:32.005 Waiting 1.200 sec 10.0/100: 10% astral_power | 0.0/100: 0% rage raid_movement
5:33.205 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:34.457 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:35.708 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:36.963 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:38.216 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:39.469 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:40.722 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:41.975 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:43.228 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:44.482 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:45.735 full_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:48.004 Waiting 1.000 sec 10.0/100: 10% astral_power | 0.0/100: 0% rage raid_movement
5:49.004 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage raid_movement
5:50.256 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:51.510 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:52.762 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:54.016 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:55.269 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:56.521 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:57.775 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
5:59.029 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
6:00.283 full_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
6:02.786 stellar_flare Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
6:04.039 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage raid_movement
6:05.293 starfall Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
6:06.546 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:07.551 lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment
6:09.220 stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:10.474 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
6:11.729 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
6:12.981 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
6:14.234 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
6:15.487 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage
6:16.740 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:17.995 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:19.249 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:20.501 Waiting 0.700 sec 20.0/100: 20% astral_power | 0.0/100: 0% rage raid_movement
6:21.201 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:22.453 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:23.706 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:24.959 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:26.211 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:27.464 stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:28.718 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
6:29.972 solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
6:31.227 half_moon Fluffy_Pillow 5.0/100: 5% astral_power | 0.0/100: 0% rage
6:32.899 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:34.153 moonfire Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:35.408 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:36.661 Waiting 0.500 sec 25.0/100: 25% astral_power | 0.0/100: 0% rage raid_movement
6:37.161 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:38.415 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:39.669 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:40.922 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:42.174 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:43.428 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:44.681 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:45.934 full_moon Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage
6:48.436 celestial_alignment Fluffy_Pillow 65.0/100: 65% astral_power | 0.0/100: 0% rage
6:48.436 starsurge Fluffy_Pillow 65.0/100: 65% astral_power | 0.0/100: 0% rage celestial_alignment
6:49.688 solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:50.691 lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 33633 33633 20083
Intellect 33144 31437 22615 (10724)
Spirit 0 0 0
Health 2017980 2017980 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 33144 31437 0
Crit 17.45% 17.45% 4356
Haste 20.02% 18.86% 6130
Damage / Heal Versatility 2.47% 2.47% 990
Attack Power 9353 9028 0
Mastery 50.72% 50.72% 6075
Armor 7628 2034 2034
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 854.00
Local Head Purified Vision of Sargeras
ilevel: 840, stats: { 259 Armor, +1182 AgiInt, +1773 Sta, +763 Haste, +494 Crit }
Local Neck Inspector's Pendant
ilevel: 865, stats: { +1258 Sta, +1262 Mastery, +679 Vers }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }
Local Shirt Gray Woolen Shirt
ilevel: 1
Local Chest Hide of Fenryr
ilevel: 840, stats: { 318 Armor, +1772 Sta, +1182 AgiInt, +736 Haste, +521 Mastery }, gems: { +150 Haste }
Local Waist Dreadhide Girdle
ilevel: 835, stats: { 176 Armor, +846 AgiInt, +1269 Sta, +542 Crit, +384 Haste }
Local Legs Tranquil Bough Pants
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +932 Haste, +372 Mastery }
Local Feet Mana-Tanned Sandals
ilevel: 860, stats: { 234 Armor, +1601 Sta, +1068 AgiInt, +704 Mastery, +311 Crit }
Local Wrists Oneth's Intuition
ilevel: 895, stats: { 167 Armor, +1665 Sta, +1110 AgiInt, +496 Crit, +372 Haste }
Local Hands Seaweed "Leather" Mitts
ilevel: 860, stats: { 213 Armor, +1601 Sta, +1068 AgiInt, +704 Crit, +311 Vers, +435 Avoidance }
Local Finger1 Loop of Vitriolic Intent
ilevel: 840, stats: { +997 Sta, +1213 Haste, +555 Mastery }
Local Finger2 Mindrend Band
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Haste }
Local Trinket1 Nightmare Bloom
ilevel: 840, stats: { +1123 Int, +898 Haste }
Local Trinket2 Twisting Wind
ilevel: 850, stats: { +1233 AgiInt }, gems: { +150 Mastery }
Local Back Cloak of Unwavering Loyalty
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +481 Crit, +267 Mastery }
Local Main Hand Scythe of Elune
ilevel: 877, weapon: { 4315 - 6474, 3.6 }, stats: { +1668 Int, +2502 Sta, +734 Crit, +705 Mastery, +9100 Int }, relics: { +40 ilevels, +42 ilevels, +45 ilevels }
Local Tabard Orgrimmar Tabard
ilevel: 600

Talents

Level
15 Force of Nature (Balance Druid) Warrior of Elune (Balance Druid) Starlord (Balance Druid)
30 Renewal Displacer Beast Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Incarnation: Chosen of Elune Stellar Flare (Balance Druid)
90 Shooting Stars (Balance Druid) Astral Communion (Balance Druid) Blessing of the Ancients (Balance Druid)
100 Fury of Elune (Balance Druid) Stellar Drift (Balance Druid) Nature's Balance (Balance Druid)

Profile

druid="Buuey"
origin="https://us.api.battle.net/wow/character/thrall/Buuey/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/220/133788636-avatar.jpg"
level=110
race=tauren
role=spell
position=back
professions=jewelcrafting=722/leatherworking=752
talents=3223333
artifact=59:0:0:0:0:1034:3:1035:3:1036:3:1038:3:1039:3:1040:3:1044:1:1045:1:1047:1:1048:1:1049:1:1294:1
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/moonkin_form
actions.precombat+=/blessing_of_elune
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/new_moon

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
actions+=/blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
actions+=/blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/berserking,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
actions+=/call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
actions+=/new_moon,if=(charges=2&recharge_time<5)|charges=3
actions+=/half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
actions+=/full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
actions+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions+=/astral_communion,if=astral_power.deficit>=75
actions+=/incarnation,if=astral_power>=40
actions+=/celestial_alignment,if=astral_power>=40
actions+=/starfall,if=buff.oneths_overconfidence.up
actions+=/solar_wrath,if=buff.solar_empowerment.stack=3
actions+=/lunar_strike,if=buff.lunar_empowerment.stack=3
actions+=/call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=single_target

actions.celestial_alignment_phase=starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.celestial_alignment_phase+=/starsurge,if=active_enemies<=2
actions.celestial_alignment_phase+=/warrior_of_elune
actions.celestial_alignment_phase+=/lunar_strike,if=buff.warrior_of_elune.up
actions.celestial_alignment_phase+=/solar_wrath,if=buff.solar_empowerment.up
actions.celestial_alignment_phase+=/lunar_strike,if=buff.lunar_empowerment.up
actions.celestial_alignment_phase+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.celestial_alignment_phase+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.celestial_alignment_phase+=/solar_wrath

actions.ed=astral_communion,if=astral_power.deficit>=75&buff.the_emerald_dreamcatcher.up
actions.ed+=/incarnation,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/celestial_alignment,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/starsurge,if=(buff.the_emerald_dreamcatcher.up&buff.the_emerald_dreamcatcher.remains<gcd.max)|astral_power>=90|((buff.celestial_alignment.up|buff.incarnation.up)&astral_power>=85)
actions.ed+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions.ed+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions.ed+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=12&dot.sunfire.remains<5.4&dot.moonfire.remains>6.6
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=8&(!(buff.celestial_alignment.up|buff.incarnation.up)|(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=77)
actions.ed+=/new_moon,if=astral_power<=90
actions.ed+=/half_moon,if=astral_power<=80
actions.ed+=/full_moon,if=astral_power<=60
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up
actions.ed+=/solar_wrath

actions.fury_of_elune=incarnation,if=astral_power>=95&cooldown.fury_of_elune.remains<=gcd
actions.fury_of_elune+=/fury_of_elune,if=astral_power>=95
actions.fury_of_elune+=/new_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=90))
actions.fury_of_elune+=/half_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=80))
actions.fury_of_elune+=/full_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=60))
actions.fury_of_elune+=/astral_communion,if=buff.fury_of_elune_up.up&astral_power<=25
actions.fury_of_elune+=/warrior_of_elune,if=buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.up)
actions.fury_of_elune+=/lunar_strike,if=buff.warrior_of_elune.up&(astral_power<=90|(astral_power<=85&buff.incarnation.up))
actions.fury_of_elune+=/new_moon,if=astral_power<=90&buff.fury_of_elune_up.up
actions.fury_of_elune+=/half_moon,if=astral_power<=80&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/full_moon,if=astral_power<=60&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/moonfire,if=buff.fury_of_elune_up.down&remains<=6.6
actions.fury_of_elune+=/sunfire,if=buff.fury_of_elune_up.down&remains<5.4
actions.fury_of_elune+=/stellar_flare,if=remains<7.2&active_enemies=1
actions.fury_of_elune+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>10
actions.fury_of_elune+=/starsurge,if=active_enemies<=2&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>7
actions.fury_of_elune+=/starsurge,if=buff.fury_of_elune_up.down&((astral_power>=92&cooldown.fury_of_elune.remains>gcd*3)|(cooldown.warrior_of_elune.remains<=5&cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.stack<2))
actions.fury_of_elune+=/solar_wrath,if=buff.solar_empowerment.up
actions.fury_of_elune+=/lunar_strike,if=buff.lunar_empowerment.stack=3|(buff.lunar_empowerment.remains<5&buff.lunar_empowerment.up)|active_enemies>=2
actions.fury_of_elune+=/solar_wrath

actions.single_target=new_moon,if=astral_power<=90
actions.single_target+=/half_moon,if=astral_power<=80
actions.single_target+=/full_moon,if=astral_power<=60
actions.single_target+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.single_target+=/starsurge,if=active_enemies<=2
actions.single_target+=/warrior_of_elune
actions.single_target+=/lunar_strike,if=buff.warrior_of_elune.up
actions.single_target+=/solar_wrath,if=buff.solar_empowerment.up
actions.single_target+=/lunar_strike,if=buff.lunar_empowerment.up
actions.single_target+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.single_target+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.single_target+=/solar_wrath

head=purified_vision_of_sargeras,id=139946
neck=inspectors_pendant,id=139990,bonus_id=3432/1527/3337
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1472
back=cloak_of_unwavering_loyalty,id=134412,bonus_id=1727/1507/3337
chest=hide_of_fenryr,id=133615,bonus_id=1727/1808/1492/1813,gems=150haste
shirt=gray_woolen_shirt,id=2587
tabard=orgrimmar_tabard,id=118372
wrists=oneths_intuition,id=137092,bonus_id=1811
hands=seaweed_leather_mitts,id=141440,bonus_id=40/1472
waist=dreadhide_girdle,id=121299,bonus_id=3432/1497/1674
legs=tranquil_bough_pants,id=139068,bonus_id=3432/1512/3337
feet=manatanned_sandals,id=141430,bonus_id=1472
finger1=loop_of_vitriolic_intent,id=134530,bonus_id=1727/1492/1813
finger2=mindrend_band,id=138220,bonus_id=1807/1472
trinket1=nightmare_bloom,id=121311,bonus_id=3432/604/1502/3336
trinket2=twisting_wind,id=139323,bonus_id=1807/1808/1472,gems=150mastery
main_hand=scythe_of_elune,id=128858,bonus_id=722,gem_id=137420/141256/139269/0,relic_id=1727:1492:1813/3474:1507:1674/1807:1477:3336/0

# Gear Summary
# gear_ilvl=853.80
# gear_stamina=20083
# gear_intellect=22615
# gear_crit_rating=4356
# gear_haste_rating=6130
# gear_mastery_rating=6075
# gear_versatility_rating=990
# gear_avoidance_rating=435
# gear_armor=2034

Oinkie

Oinkie : 267994 dps, 172794 dps to main target

  • Race: Tauren
  • Class: Druid
  • Spec: Feral
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
267993.5 267993.5 176.1 / 0.066% 35124.8 / 13.1% 17998.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.9 14.9 Energy 20.13% 45.9 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Oinkie/advanced
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Balance Affinity
  • 60: Mighty Bash
  • 75: Incarnation: King of the Jungle (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact
Professions
  • herbalism: 815
  • inscription: 713
Scale Factors for Oinkie Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 9.35 6.39 5.93 5.11 4.07
Normalized 1.00 0.68 0.63 0.55 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.22 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.35, CritRating=5.93, HasteRating=5.11, MasteryRating=4.07, Versatility=6.39 )

Scale Factors for other metrics

Scale Factors for Oinkie Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 9.35 6.39 5.93 5.11 4.07
Normalized 1.00 0.68 0.63 0.55 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.22 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.35, CritRating=5.93, HasteRating=5.11, MasteryRating=4.07, Versatility=6.39 )
Scale Factors for Oinkie Priority Target Damage Per Second
Agi Vers Haste Crit Mastery
Scale Factors 6.00 4.06 3.62 3.59 2.79
Normalized 1.00 0.68 0.60 0.60 0.47
Scale Deltas 1138 1138 1138 1138 1138
Error 0.23 0.23 0.23 0.23 0.23
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Haste ~= Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=6.00, CritRating=3.59, HasteRating=3.62, MasteryRating=2.79, Versatility=4.06 )
Scale Factors for Oinkie Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 9.35 6.39 5.93 5.11 4.07
Normalized 1.00 0.68 0.63 0.55 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.35, CritRating=5.93, HasteRating=5.11, MasteryRating=4.07, Versatility=6.39 )
Scale Factors for Oinkie Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for OinkieTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Oinkie 267994
Ashamane's Rip 10153 3.9% 7.7 48.15sec 536706 0 Periodic 67.7 46109 94007 61414 32.0% 21.8%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.75 0.00 67.71 67.71 0.0000 1.2916 4158434.85 4158434.85 0.00 47551.05 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.1 68.05% 46108.79 32 54116 45883.87 0 54116 2124448 2124448 0.00
crit 21.6 31.95% 94006.59 65 110397 93484.65 0 110397 2033987 2033987 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 25310 9.5% 432.3 0.93sec 23473 28404 Direct 432.3 17622 35952 23473 31.9%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 432.30 432.30 0.00 0.00 0.8264 0.0000 10147553.01 14362279.85 29.35 28404.23 28404.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 294.31 68.08% 17622.02 16076 21361 17623.98 17383 17930 5186329 7340323 29.34
crit 138.00 31.92% 35952.17 32795 43575 35956.34 34991 36911 4961224 7021957 29.34
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7196 2.7% 14.8 28.20sec 199150 198258 Direct 14.8 142024 320901 199150 31.9%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.78 14.78 0.00 0.00 1.0045 0.0000 2942948.81 4161255.00 29.28 198258.48 198258.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.06 68.06% 142023.64 14167 180864 140053.03 36627 173000 1428483 2019774 29.23
crit 4.72 31.94% 320900.75 31629 408463 313872.11 0 408463 1514466 2141481 28.97
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s231056[When used on targets below 25% health, ][]{$?s231056=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 13457 5.1% 17.5 23.65sec 311393 310005 Direct 17.5 32648 66629 43494 31.9%  
Periodic 147.5 23809 48574 31738 32.0% 59.4%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.48 17.48 147.53 147.53 1.0045 1.6155 5442444.96 5442444.96 0.00 21269.52 310004.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.90 68.08% 32648.01 30057 38022 32683.45 30057 35717 388489 388489 0.00
crit 5.58 31.92% 66628.54 61316 77564 66561.64 0 77564 371674 371674 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.3 67.98% 23808.84 278 29573 23784.57 22316 25536 2387683 2387683 0.00
crit 47.2 32.02% 48573.94 568 60328 48525.71 43603 52047 2294599 2294599 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11151 4.1% 24.3 13.89sec 181324 0 Direct 24.3 136135 277545 181326 32.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.32 24.32 0.00 0.00 0.0000 0.0000 4410681.98 6484120.30 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.55 68.04% 136134.50 122155 154527 136111.24 124870 147328 2253237 3312472 31.98
crit 7.77 31.96% 277544.64 249197 315234 277477.70 0 315234 2157445 3171648 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 24623 9.3% 19.1 22.42sec 523453 521116 Direct 19.1 66976 137142 89322 31.9%  
Periodic 111.2 55940 114222 74539 31.9% 46.6%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.09 19.09 111.16 111.16 1.0045 1.6800 9990313.58 9990313.58 0.00 48515.74 521115.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.01 68.15% 66975.65 48771 123390 66988.75 48771 92746 871095 871095 0.00
crit 6.08 31.85% 137142.36 99492 251716 136946.28 0 251716 833664 833664 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.7 68.09% 55940.08 97 123390 55956.71 44970 66327 4233844 4233844 0.00
crit 35.5 31.91% 114222.24 198 251716 114283.77 63112 160072 4051711 4051711 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][]$?a231052[ While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 46405 17.3% 23.3 14.28sec 797655 794112 Periodic 311.8 44731 91259 59613 32.0% 101.7%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.31 0.00 311.83 311.83 1.0045 1.3078 18589374.44 18589374.44 0.00 43108.39 794112.28
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 212.1 68.01% 44730.56 32 54116 44695.30 42008 47083 9486899 9486899 0.00
crit 99.7 31.99% 91258.82 65 110397 91189.69 83568 97072 9102475 9102475 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 23143 8.8% 51.4 7.85sec 183106 182288 Direct 51.4 75265 217164 183107 76.0%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.40 51.40 0.00 0.00 1.0045 0.0000 9412429.26 13285283.02 29.15 182287.78 182287.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.34 24.00% 75264.63 58403 84656 74994.32 0 84149 928538 1315808 29.40
crit 39.07 76.00% 217164.38 119142 284954 217723.30 197520 251288 8483891 11969475 29.12
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing ${$sw1*$<mult>} Physical damage to the target.$?a231063[ Deals {$s5=20}% increased damage against bleeding targets.][]$?a231057[ While stealthed, Shred deals $m4% increased damage, and has double the chance to critically strike.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Swipe (_cat) 73172 27.0% 71.6 4.07sec 403680 401874 Direct 429.9 50508 103034 67279 31.9%  

Stats details: swipe_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.65 429.89 0.00 0.00 1.0045 0.0000 28922840.93 42084471.57 31.27 401873.57 401873.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 292.63 68.07% 50508.17 39094 62334 50486.44 47573 52788 14780183 21506018 31.27
crit 137.26 31.93% 103033.90 79751 127161 102992.50 97020 108771 14142658 20578453 31.27
 
 

Action details: swipe_cat

Static Values
  • id:106785
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.swipe_cat>=8
Spelldata
  • id:106785
  • name:Swipe
  • school:physical
  • tooltip:
  • description:Swipe nearby enemies, inflicting $sw3 Physical damage.$?a231283[ Deals {$s2=20}% increased damage against bleeding targets.][] |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Thrash (_cat) 33385 12.3% 24.5 12.08sec 537491 535087 Direct 147.2 18748 38250 24978 31.9%  
Periodic 566.9 12591 25684 16779 32.0% 271.8%

Stats details: thrash_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.54 147.23 566.87 566.87 1.0045 1.9222 13189349.04 13189349.04 0.00 11836.74 535086.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.19 68.05% 18748.08 18121 22923 18741.96 18121 19576 1878454 1878454 0.00
crit 47.04 31.95% 38249.83 36967 46764 38237.19 36967 40378 1799203 1799203 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 385.5 68.01% 12590.83 6 16327 12591.74 11760 13617 4854216 4854216 0.00
crit 181.3 31.99% 25684.03 15 33306 25686.14 23216 28046 4657475 4657475 0.00
 
 

Action details: thrash_cat

Static Values
  • id:106830
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=duration*0.3&spell_targets.thrash_cat>=5
Spelldata
  • id:106830
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:Strikes all nearby enemies, dealing $m1 Bleed damage and an additional $o2 Bleed damage over {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.410000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.292000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:10.05
  • base_tick_time:2.01
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Oinkie
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Dash 2.4 188.73sec

Stats details: dash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.37 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dash

Static Values
  • id:1850
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.cat_form.up
Spelldata
  • id:1850
  • name:Dash
  • school:physical
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
Incarnation: King of the Jungle (incarnation) 2.7 181.02sec

Stats details: incarnation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: incarnation

Static Values
  • id:102543
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.tigers_fury.remains<gcd
Spelldata
  • id:102543
  • name:Incarnation: King of the Jungle
  • school:physical
  • tooltip:Incarnation: King of the Jungle activated.
  • description:An improved Cat Form that allows the use of Prowl while in combat, causes Shred and Rake to deal damage as if stealth were active, reduces the cost of all Cat Form abilities by {$s2=50}%, and increases maximum Energy by {$s3=50}. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Cat Form for its duration.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Skull Bash 13.5 30.24sec

Stats details: skull_bash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.53 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: skull_bash

Static Values
  • id:106839
  • school:physical
  • resource:none
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:106839
  • name:Skull Bash
  • school:physical
  • tooltip:
  • description:You charge and bash the target's skull, interrupting spellcasting and preventing any spell in that school from being cast for {$93985d=4 seconds}.
 
Tiger's Fury 13.6 30.53sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.61 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 
Wild Charge 16.1 24.34sec

Stats details: wild_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.11 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wild_charge

Static Values
  • id:102401
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102401
  • name:Wild Charge
  • school:physical
  • tooltip:Flying to an ally's position.
  • description:Fly to a nearby ally's position.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Acceleration 6.4 1.1 57.6sec 47.6sec 17.21% 17.21% 1.1(1.1) 6.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_acceleration
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:5927.22

Stack Uptimes

  • acceleration_1:17.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214128
  • name:Acceleration
  • tooltip:Haste increased by $w1. Movement speed increased by $w2%.
  • description:{$@spelldesc214120=Your spells and abilities have a chance to grant you {$214128s1=4657} Haste and {$214128s2=15}% movement speed for {$214128d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Ashamane's Energy 13.6 0.0 30.5sec 30.5sec 10.15% 10.15% 40.6(40.6) 13.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:20.00

Stack Uptimes

  • ashamanes_energy_1:10.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 9.79% 0.0(0.0) 1.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 36.9 1.0 10.7sec 10.4sec 4.99% 16.49% 1.0(1.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:4.99%

Trigger Attempt Success

  • trigger_pct:8.75%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Dash 2.4 0.0 188.6sec 188.6sec 8.70% 11.50% 0.0(0.0) 2.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_dash
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70

Stack Uptimes

  • dash_1:8.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1850
  • name:Dash
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Feral Instinct 2.7 0.0 181.0sec 181.0sec 10.04% 13.56% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_feral_instinct
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • feral_instinct_1:10.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210649
  • name:Feral Instinct
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc210631={$?s102543=false}[Incarnation: King of the Jungle][Berserk] increases all damage you deal by {$s1=5}% for {$210649d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: King of the Jungle 2.7 0.0 181.0sec 181.0sec 19.67% 41.86% 0.0(0.0) 2.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_incarnation_king_of_the_jungle
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.50

Stack Uptimes

  • incarnation_king_of_the_jungle_1:19.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:102543
  • name:Incarnation: King of the Jungle
  • tooltip:Incarnation: King of the Jungle activated.
  • description:An improved Cat Form that allows the use of Prowl while in combat, causes Shred and Rake to deal damage as if stealth were active, reduces the cost of all Cat Form abilities by {$s2=50}%, and increases maximum Energy by {$s3=50}. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Cat Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 287.3sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 15.8 21.5 25.1sec 10.8sec 83.42% 83.42% 21.5(21.5) 14.9

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:83.42%

Trigger Attempt Success

  • trigger_pct:97.82%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Regrowth, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Regrowth, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 1.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
raid_movement 33.8 1.0 11.6sec 11.3sec 6.59% 6.59% 1.0(1.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:6.59%

Trigger Attempt Success

  • trigger_pct:100.00%
Scent of Blood 24.5 0.0 12.1sec 12.1sec 24.85% 49.98% 0.0(0.0) 24.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_scent_of_blood
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-2.00

Stack Uptimes

  • scent_of_blood_1:24.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210664
  • name:Scent of Blood
  • tooltip:Energy cost of {$?s202028=false}[Brutal Slash][Swipe] reduced by $w1.
  • description:{$@spelldesc210663=Each target hit by Thrash reduces the cost of {$?s202028=false}[Brutal Slash][Swipe] by {$s1=2} Energy for the next {$210664d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Tiger's Fury 13.6 0.0 30.5sec 30.5sec 26.90% 31.10% 0.0(0.0) 13.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
wild_charge_movement 16.1 0.0 24.4sec 24.4sec 0.98% 14.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_wild_charge_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • wild_charge_movement_1:0.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Cat Form

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Defiled Augmentation

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Oinkie
ferocious_bite Energy 29.6 455.1 15.4 30.8 6466.6
ferocious_bite Combo Points 14.8 70.1 4.7 4.7 41998.3
lunar_inspiration Energy 17.5 392.6 22.5 22.5 13861.1
rake Energy 19.1 527.9 27.7 27.7 18926.0
rip Energy 23.3 486.5 20.9 20.9 38213.1
rip Combo Points 23.3 116.5 5.0 5.0 159531.2
shred Energy 51.4 1263.5 24.6 24.6 7449.3
swipe_cat Energy 71.6 1933.8 27.0 27.0 14956.5
thrash_cat Energy 24.5 897.2 36.6 36.6 14701.1
Resource Gains Type Count Total Average Overflow
rake Combo Points 19.09 19.02 (10.01%) 1.00 0.06 0.33%
tigers_fury Energy 13.61 272.10 (3.79%) 20.00 0.00 0.00%
swipe_cat Combo Points 71.65 0.70 (0.37%) 0.01 0.01 1.83%
lunar_inspiration Combo Points 17.48 17.42 (9.17%) 1.00 0.06 0.32%
shred Combo Points 51.41 51.35 (27.03%) 1.00 0.06 0.12%
energy_regen Energy 1581.62 4815.63 (67.00%) 3.04 21.43 0.44%
clearcasting Energy 36.76 1294.38 (18.01%) 35.22 0.00 0.00%
ashamanes_energy Energy 40.62 805.08 (11.20%) 19.82 7.40 0.91%
primal_fury Combo Points 115.27 101.46 (53.41%) 0.88 13.81 11.98%
Resource RPS-Gain RPS-Loss
Energy 14.70 14.86
Combo Points 0.47 0.47
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 34.64 0.01 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.34 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.2%

Procs

Count Interval
clearcasting 37.8 10.4sec
clearcasting_wasted 1.0 105.3sec
primal_fury 115.3 3.5sec

Statistics & Data Analysis

Fight Length
Sample Data Oinkie Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Oinkie Damage Per Second
Count 9999
Mean 267993.50
Minimum 234100.61
Maximum 304066.79
Spread ( max - min ) 69966.18
Range [ ( max - min ) / 2 * 100% ] 13.05%
Standard Deviation 8986.7918
5th Percentile 253661.01
95th Percentile 283120.56
( 95th Percentile - 5th Percentile ) 29459.55
Mean Distribution
Standard Deviation 89.8724
95.00% Confidence Intervall ( 267817.36 - 268169.65 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4319
0.1 Scale Factor Error with Delta=300 689434
0.05 Scale Factor Error with Delta=300 2757738
0.01 Scale Factor Error with Delta=300 68943452
Priority Target DPS
Sample Data Oinkie Priority Target Damage Per Second
Count 9999
Mean 172793.88
Minimum 141781.45
Maximum 197124.06
Spread ( max - min ) 55342.61
Range [ ( max - min ) / 2 * 100% ] 16.01%
Standard Deviation 9215.3714
5th Percentile 156517.07
95th Percentile 186079.81
( 95th Percentile - 5th Percentile ) 29562.74
Mean Distribution
Standard Deviation 92.1583
95.00% Confidence Intervall ( 172613.25 - 172974.50 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10926
0.1 Scale Factor Error with Delta=300 724952
0.05 Scale Factor Error with Delta=300 2899808
0.01 Scale Factor Error with Delta=300 72495217
DPS(e)
Sample Data Oinkie Damage Per Second (Effective)
Count 9999
Mean 267993.50
Minimum 234100.61
Maximum 304066.79
Spread ( max - min ) 69966.18
Range [ ( max - min ) / 2 * 100% ] 13.05%
Damage
Sample Data Oinkie Damage
Count 9999
Mean 107206370.86
Minimum 79491772.05
Maximum 136371390.66
Spread ( max - min ) 56879618.61
Range [ ( max - min ) / 2 * 100% ] 26.53%
DTPS
Sample Data Oinkie Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Oinkie Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Oinkie Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Oinkie Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Oinkie Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Oinkie Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data OinkieTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Oinkie Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 cat_form
4 0.00 prowl
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
7 16.11 wild_charge
0.00 displacer_beast,if=movement.distance>10
8 2.37 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
9 1.00 rake,if=buff.prowl.up
A 34.76 auto_attack
B 13.53 skull_bash
0.00 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 13.67 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
E 2.74 incarnation,if=energy.time_to_max>1&energy>=35
F 2.85 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
0.00 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
J 24.54 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 23.31 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
0.00 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
L 0.89 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 11.93 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
0.00 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
N 70.76 swipe_cat,if=spell_targets.swipe_cat>=6
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 18.09 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 17.48 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 51.41 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

0123469AEDPBQKQQQMQQQM7PAOQQKQQQ8JLAKNNNNN7JANKNNNDNFJNNBOPQ7AKJANN7AJNNDNKNNOP7AQBKAJNN7AJDNNNKOP7AQAJBNKJNN7NANDNKJOPQKAJNNNJBN7ADNNJKOPQJ7NAAKNNNJNEFDN7JABNOPQKQQQMQQ8JANK7ANNJNNNNKNNDJNAOPKBQQQ7AJNKANJNDBNNO7APKQQAJBNK7ANJNNNNDOKPQ7AQQBKAJNNN7AJNNNNNKDOPQQAQFOPQB7AQOMDPQQQKAOPQMQO7APECMQQBDQMOQQMQQP8AMQOQMQQPMOAQDQMQOQB

Sample Sequence Table

time name target resources buffs
Pre flask Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre food Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre augmentation Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points acceleration, potion_of_the_old_war
0:01.006 incarnation Fluffy_Pillow 79.7/100: 80% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, acceleration, potion_of_the_old_war
0:01.006 tigers_fury Fluffy_Pillow 79.7/150: 53% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, acceleration, potion_of_the_old_war
0:01.006 lunar_inspiration Fluffy_Pillow 99.7/150: 66% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, tigers_fury, acceleration, potion_of_the_old_war
0:02.010 skull_bash Fluffy_Pillow 122.4/150: 82% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, tigers_fury, acceleration, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 122.4/150: 82% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, tigers_fury, acceleration, potion_of_the_old_war
0:03.013 rip Fluffy_Pillow 140.0/150: 93% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, tigers_fury, acceleration, potion_of_the_old_war
0:04.017 shred Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
0:05.023 shred Fluffy_Pillow 147.7/150: 98% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
0:06.029 shred Fluffy_Pillow 145.4/150: 97% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
0:07.033 ferocious_bite Fluffy_Pillow 143.1/150: 95% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
0:08.036 shred Fluffy_Pillow 135.7/150: 90% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
0:09.040 shred Fluffy_Pillow 133.4/150: 89% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration, potion_of_the_old_war
0:10.044 shred Fluffy_Pillow 130.9/150: 87% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:11.049 ferocious_bite Fluffy_Pillow 125.7/150: 84% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:12.054 wild_charge Fluffy_Pillow 115.5/150: 77% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, raid_movement, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:12.054 lunar_inspiration Fluffy_Pillow 115.5/150: 77% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, raid_movement, wild_charge_movement, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:12.254 auto_attack Fluffy_Pillow 100.5/150: 67% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:13.059 rake Fluffy_Pillow 115.4/150: 77% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:14.064 shred Fluffy_Pillow 112.7/150: 75% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:15.069 shred Fluffy_Pillow 107.5/150: 72% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:16.073 rip Fluffy_Pillow 102.3/150: 68% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:17.077 shred Fluffy_Pillow 102.1/150: 68% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:18.081 shred Fluffy_Pillow 96.9/150: 65% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:19.086 shred Fluffy_Pillow 91.7/150: 61% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:20.090 dash Fluffy_Pillow 86.5/150: 58% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:20.090 thrash_cat Fluffy_Pillow 86.5/150: 58% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:21.094 swipe_cat Fluffy_Pillow 76.3/150: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, potion_of_the_old_war
0:21.694 auto_attack Fluffy_Pillow 59.8/150: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, potion_of_the_old_war
0:22.096 rip Fluffy_Pillow_Add1 74.6/150: 50% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, potion_of_the_old_war
0:23.102 swipe_cat Fluffy_Pillow 74.5/150: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
0:24.107 swipe_cat Fluffy_Pillow 74.7/150: 50% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:25.111 swipe_cat Fluffy_Pillow 69.8/150: 47% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:26.118 swipe_cat Fluffy_Pillow 65.1/150: 43% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:27.122 swipe_cat Fluffy_Pillow 60.2/150: 40% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:28.126 wild_charge Fluffy_Pillow 55.4/150: 37% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:28.126 thrash_cat Fluffy_Pillow 55.4/150: 37% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, raid_movement, dash, wild_charge_movement, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
0:28.326 auto_attack Fluffy_Pillow 30.4/150: 20% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, acceleration
0:29.131 swipe_cat Fluffy_Pillow 48.1/150: 32% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, acceleration
0:30.136 rip Fluffy_Pillow 49.2/150: 33% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, acceleration
0:31.142 swipe_cat Fluffy_Pillow 51.9/100: 52% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, clearcasting, dash, predatory_swiftness, scent_of_blood, acceleration
0:32.145 swipe_cat Fluffy_Pillow 81.6/100: 82% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, dash, predatory_swiftness, acceleration
0:33.152 swipe_cat Fluffy_Pillow 54.3/100: 54% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, dash, predatory_swiftness, acceleration
0:34.158 tigers_fury Fluffy_Pillow 24.9/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, predatory_swiftness
0:34.415 swipe_cat Fluffy_Pillow 48.7/100: 49% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, ashamanes_energy, predatory_swiftness, tigers_fury
0:35.418 ferocious_bite Fluffy_Pillow_Add1 38.5/100: 39% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, ashamanes_energy, predatory_swiftness, tigers_fury
0:37.188 thrash_cat Fluffy_Pillow 66.1/100: 66% energy | 704000.0/704000: 100% mana | 0.0/5: 1% combo_points bloodlust, predatory_swiftness, tigers_fury
0:38.444 swipe_cat Fluffy_Pillow 34.6/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 1% combo_points bloodlust, predatory_swiftness, scent_of_blood, tigers_fury
0:39.449 swipe_cat Fluffy_Pillow 16.4/100: 16% energy | 704000.0/704000: 100% mana | 1.0/5: 21% combo_points bloodlust, clearcasting, predatory_swiftness, scent_of_blood, tigers_fury
0:40.454 skull_bash Fluffy_Pillow 43.3/100: 43% energy | 704000.0/704000: 100% mana | 2.1/5: 41% combo_points bloodlust, predatory_swiftness, scent_of_blood, tigers_fury
0:40.454 rake Fluffy_Pillow 43.3/100: 43% energy | 704000.0/704000: 100% mana | 2.1/5: 41% combo_points bloodlust, predatory_swiftness, scent_of_blood, tigers_fury
0:41.459 Waiting 0.337 sec 21.2/100: 21% energy | 704000.0/704000: 100% mana | 3.1/5: 61% combo_points predatory_swiftness, tigers_fury
0:41.796 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.1/5: 61% combo_points clearcasting, predatory_swiftness, tigers_fury
0:42.799 Waiting 0.400 sec 36.4/100: 36% energy | 704000.0/704000: 100% mana | 4.1/5: 81% combo_points predatory_swiftness
0:43.199 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 4.1/5: 81% combo_points predatory_swiftness
0:44.204 wild_charge Fluffy_Pillow 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness
0:44.204 Waiting 1.119 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness
0:45.323 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
0:45.323 Waiting 3.700 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
0:49.023 rip Fluffy_Pillow 67.0/100: 67% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
0:50.281 thrash_cat Fluffy_Pillow 51.2/100: 51% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness
0:52.512 auto_attack Fluffy_Pillow 24.3/100: 24% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood
0:53.336 swipe_cat Fluffy_Pillow 35.9/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood
0:57.154 swipe_cat Fluffy_Pillow 46.2/100: 46% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:00.202 wild_charge Fluffy_Pillow 35.8/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness
1:00.402 auto_attack Fluffy_Pillow 35.8/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
1:01.476 thrash_cat Fluffy_Pillow 50.2/100: 50% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points
1:03.247 swipe_cat Fluffy_Pillow 20.3/100: 20% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, scent_of_blood
1:04.251 swipe_cat Fluffy_Pillow 43.7/100: 44% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points scent_of_blood
1:05.256 tigers_fury Fluffy_Pillow 22.1/100: 22% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points scent_of_blood
1:05.256 swipe_cat Fluffy_Pillow 42.1/100: 42% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, scent_of_blood, tigers_fury
1:06.260 rip Fluffy_Pillow_Add1 40.5/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, tigers_fury
1:07.263 swipe_cat Fluffy_Pillow 71.9/100: 72% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
1:08.266 swipe_cat Fluffy_Pillow 58.2/100: 58% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
1:10.290 rake Fluffy_Pillow 36.2/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
1:11.295 Waiting 1.592 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
1:12.887 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
1:13.891 Waiting 2.141 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:16.032 wild_charge Fluffy_Pillow 36.3/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness
1:16.032 Waiting 0.200 sec 36.3/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, wild_charge_movement, predatory_swiftness
1:16.232 auto_attack Fluffy_Pillow 38.6/100: 39% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:16.232 Waiting 0.200 sec 38.6/100: 39% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:16.432 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:17.437 skull_bash Fluffy_Pillow 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
1:17.437 Waiting 1.621 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
1:19.058 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
1:22.563 auto_attack Fluffy_Pillow 38.2/100: 38% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
1:23.639 thrash_cat Fluffy_Pillow 52.6/100: 53% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
1:26.434 swipe_cat Fluffy_Pillow 34.3/100: 34% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood
1:30.508 swipe_cat Fluffy_Pillow 47.5/100: 48% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:32.022 wild_charge Fluffy_Pillow 19.7/100: 20% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement
1:32.222 auto_attack Fluffy_Pillow 19.7/100: 20% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points
1:34.833 thrash_cat Fluffy_Pillow 51.6/100: 52% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points
1:35.837 tigers_fury Fluffy_Pillow 13.0/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points scent_of_blood
1:36.093 swipe_cat Fluffy_Pillow 35.9/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, scent_of_blood, tigers_fury
1:37.097 swipe_cat Fluffy_Pillow 34.3/100: 34% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, scent_of_blood, tigers_fury
1:38.355 swipe_cat Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, scent_of_blood, tigers_fury
1:39.359 rip Fluffy_Pillow 33.9/100: 34% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury
1:42.153 rake Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, tigers_fury
1:43.158 Waiting 1.642 sec 12.0/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
1:44.800 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:45.806 Waiting 2.239 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:48.045 wild_charge Fluffy_Pillow 37.5/100: 37% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, predatory_swiftness
1:48.045 Waiting 0.200 sec 37.5/100: 37% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, wild_charge_movement, predatory_swiftness
1:48.245 auto_attack Fluffy_Pillow 39.7/100: 40% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:48.245 Waiting 0.100 sec 39.7/100: 40% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:48.345 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
1:49.351 Waiting 1.120 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
1:52.512 auto_attack Fluffy_Pillow 48.1/100: 48% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points
1:52.769 thrash_cat Fluffy_Pillow 51.1/100: 51% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points
1:54.285 skull_bash Fluffy_Pillow 18.3/100: 18% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points scent_of_blood
1:55.813 swipe_cat Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points scent_of_blood
1:58.354 rip Fluffy_Pillow 31.4/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
2:01.150 thrash_cat Fluffy_Pillow 36.6/100: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, acceleration
2:02.155 swipe_cat Fluffy_Pillow 50.2/100: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood, acceleration
2:03.159 swipe_cat Fluffy_Pillow 30.8/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, scent_of_blood, acceleration
2:04.163 wild_charge Fluffy_Pillow 56.4/100: 56% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness, scent_of_blood, acceleration
2:04.163 swipe_cat Fluffy_Pillow 56.4/100: 56% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, wild_charge_movement, predatory_swiftness, scent_of_blood, acceleration
2:04.263 auto_attack Fluffy_Pillow 23.4/100: 23% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points wild_charge_movement, predatory_swiftness, scent_of_blood, acceleration
2:05.937 swipe_cat Fluffy_Pillow 47.4/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, acceleration
2:06.943 tigers_fury Fluffy_Pillow 16.0/100: 16% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, acceleration
2:07.707 swipe_cat Fluffy_Pillow 46.3/100: 46% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
2:08.711 rip Fluffy_Pillow_Add1 34.9/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
2:09.975 thrash_cat Fluffy_Pillow 61.1/100: 61% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, tigers_fury
2:12.261 rake Fluffy_Pillow 37.1/100: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood, tigers_fury
2:13.266 Waiting 1.518 sec 13.5/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, scent_of_blood, tigers_fury
2:14.784 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
2:15.787 Waiting 2.441 sec 12.0/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
2:18.228 shred Fluffy_Pillow 39.7/100: 40% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
2:19.231 rip Fluffy_Pillow 51.1/100: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
2:20.436 auto_attack Fluffy_Pillow 32.5/100: 33% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
2:22.027 thrash_cat Fluffy_Pillow 53.2/100: 53% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, acceleration
2:24.309 swipe_cat Fluffy_Pillow 34.1/100: 34% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood, acceleration
2:26.083 swipe_cat Fluffy_Pillow 25.1/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, acceleration
2:27.600 swipe_cat Fluffy_Pillow 45.7/100: 46% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, acceleration
2:31.419 thrash_cat Fluffy_Pillow 52.3/100: 52% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points acceleration
2:32.423 skull_bash Fluffy_Pillow 14.6/100: 15% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points scent_of_blood
2:34.211 swipe_cat Fluffy_Pillow 34.9/100: 35% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points scent_of_blood
2:36.234 wild_charge Fluffy_Pillow 24.9/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points raid_movement
2:36.334 auto_attack Fluffy_Pillow 24.9/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points wild_charge_movement
2:36.744 tigers_fury Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points
2:36.943 swipe_cat Fluffy_Pillow 52.9/100: 53% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, tigers_fury
2:38.459 swipe_cat Fluffy_Pillow 45.1/100: 45% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, tigers_fury
2:39.973 thrash_cat Fluffy_Pillow_Add1 57.3/100: 57% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury
2:40.978 Waiting 1.056 sec 18.7/100: 19% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points scent_of_blood, tigers_fury
2:42.034 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points scent_of_blood, tigers_fury
2:43.551 rake Fluffy_Pillow 17.9/100: 18% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, scent_of_blood, tigers_fury
2:44.557 Waiting 0.100 sec 29.3/100: 29% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
2:44.657 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
2:45.661 Waiting 2.563 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
2:48.224 shred Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, acceleration
2:49.227 Waiting 0.773 sec 14.5/100: 15% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, acceleration
2:50.000 thrash_cat Fluffy_Pillow_Add1 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, clearcasting, predatory_swiftness, acceleration
2:51.003 wild_charge Fluffy_Pillow 38.6/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, scent_of_blood, acceleration
2:51.234 swipe_cat Fluffy_Pillow 41.7/100: 42% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness, scent_of_blood, acceleration
2:51.534 auto_attack Fluffy_Pillow 8.7/100: 9% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, scent_of_blood, acceleration
2:52.438 auto_attack Fluffy_Pillow 22.3/100: 22% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, scent_of_blood, acceleration
2:53.007 rip Fluffy_Pillow_Add1 32.7/100: 33% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, scent_of_blood, acceleration
2:54.012 swipe_cat Fluffy_Pillow 16.3/100: 16% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, acceleration
2:55.017 swipe_cat Fluffy_Pillow 29.9/100: 30% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, acceleration
2:56.275 swipe_cat Fluffy_Pillow 46.9/100: 47% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, acceleration
3:00.350 thrash_cat Fluffy_Pillow_Add1 52.3/100: 52% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points predatory_swiftness
3:03.143 swipe_cat Fluffy_Pillow 34.0/100: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points predatory_swiftness, scent_of_blood
3:06.192 incarnation Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points
3:06.192 ferocious_bite Fluffy_Pillow_Add1 35.6/150: 24% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points incarnation_king_of_the_jungle, feral_instinct
3:07.198 tigers_fury Fluffy_Pillow 22.0/150: 15% energy | 704000.0/704000: 100% mana | 0.0/5: 1% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:07.198 swipe_cat Fluffy_Pillow 42.0/150: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 1% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury
3:08.202 wild_charge Fluffy_Pillow 50.9/150: 34% energy | 704000.0/704000: 100% mana | 0.1/5: 1% combo_points raid_movement, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury
3:08.202 thrash_cat Fluffy_Pillow_Add1 50.9/150: 34% energy | 704000.0/704000: 100% mana | 0.1/5: 1% combo_points raid_movement, wild_charge_movement, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury
3:08.402 auto_attack Fluffy_Pillow 25.9/150: 17% energy | 704000.0/704000: 100% mana | 0.1/5: 1% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
3:09.205 skull_bash Fluffy_Pillow 57.3/150: 38% energy | 704000.0/704000: 100% mana | 0.1/5: 1% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
3:09.205 swipe_cat Fluffy_Pillow 57.3/150: 38% energy | 704000.0/704000: 100% mana | 0.1/5: 1% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
3:10.210 rake Fluffy_Pillow 72.2/150: 48% energy | 704000.0/704000: 100% mana | 1.1/5: 21% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, scent_of_blood, tigers_fury
3:11.214 lunar_inspiration Fluffy_Pillow 66.0/150: 44% energy | 704000.0/704000: 100% mana | 2.1/5: 41% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, scent_of_blood, tigers_fury
3:12.218 shred Fluffy_Pillow 62.4/150: 42% energy | 704000.0/704000: 100% mana | 3.1/5: 61% combo_points clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury
3:13.223 rip Fluffy_Pillow 73.8/150: 49% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury
3:14.227 shred Fluffy_Pillow 70.2/150: 47% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury
3:15.231 shred Fluffy_Pillow 61.6/150: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:16.235 shred Fluffy_Pillow 53.0/150: 35% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:17.240 ferocious_bite Fluffy_Pillow 44.4/150: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:18.245 shred Fluffy_Pillow 43.3/150: 29% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:19.249 shred Fluffy_Pillow 34.7/150: 23% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:20.252 dash Fluffy_Pillow 26.1/150: 17% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:20.252 thrash_cat Fluffy_Pillow_Add1 26.1/150: 17% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, dash, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:21.769 auto_attack Fluffy_Pillow 18.3/150: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:21.769 swipe_cat Fluffy_Pillow 18.3/150: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:23.026 rip Fluffy_Pillow 16.0/150: 11% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:24.028 wild_charge Fluffy_Pillow 12.4/150: 8% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:24.228 auto_attack Fluffy_Pillow 12.4/150: 8% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:25.051 swipe_cat Fluffy_Pillow 24.0/150: 16% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
3:27.078 swipe_cat Fluffy_Pillow 24.5/150: 16% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
3:29.360 thrash_cat Fluffy_Pillow_Add1 27.9/150: 19% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
3:30.620 swipe_cat Fluffy_Pillow 17.2/150: 11% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:31.623 swipe_cat Fluffy_Pillow 34.6/150: 23% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points clearcasting, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:32.628 swipe_cat Fluffy_Pillow 52.0/150: 35% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:33.633 swipe_cat Fluffy_Pillow 46.9/150: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points clearcasting, dash, incarnation_king_of_the_jungle, predatory_swiftness
3:34.636 rip Fluffy_Pillow_Add1 58.2/150: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
3:35.640 swipe_cat Fluffy_Pillow 54.6/150: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, predatory_swiftness
3:36.898 swipe_cat Fluffy_Pillow 46.4/100: 46% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
3:37.902 tigers_fury Fluffy_Pillow 12.8/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
3:38.924 thrash_cat Fluffy_Pillow_Add1 64.4/100: 64% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
3:39.927 swipe_cat Fluffy_Pillow 45.7/100: 46% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
3:40.827 auto_attack Fluffy_Pillow 12.7/100: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
3:40.931 rake Fluffy_Pillow 44.1/100: 44% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, scent_of_blood, tigers_fury
3:41.936 Waiting 0.893 sec 20.5/100: 21% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, scent_of_blood, tigers_fury
3:42.829 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, scent_of_blood, tigers_fury
3:43.834 Waiting 1.640 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
3:45.474 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
3:46.477 skull_bash Fluffy_Pillow 12.0/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
3:46.477 shred Fluffy_Pillow 12.0/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
3:47.482 Waiting 1.336 sec 23.4/100: 23% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
3:48.818 shred Fluffy_Pillow 38.6/100: 39% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness
3:49.822 shred Fluffy_Pillow 50.0/100: 50% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
3:50.826 wild_charge Fluffy_Pillow 21.4/100: 21% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness
3:51.183 auto_attack Fluffy_Pillow 24.3/100: 24% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement, predatory_swiftness
3:52.101 thrash_cat Fluffy_Pillow_Add1 35.8/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
3:53.105 swipe_cat Fluffy_Pillow 47.2/100: 47% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, scent_of_blood
3:54.621 rip Fluffy_Pillow_Add1 31.4/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, scent_of_blood
3:56.847 auto_attack Fluffy_Pillow 24.4/100: 24% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
3:58.693 swipe_cat Fluffy_Pillow 47.6/100: 48% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
4:03.013 thrash_cat Fluffy_Pillow_Add1 51.6/100: 52% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
4:05.811 swipe_cat Fluffy_Pillow 33.4/100: 33% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood
4:07.839 tigers_fury Fluffy_Pillow 23.4/100: 23% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points
4:08.154 skull_bash Fluffy_Pillow 46.9/100: 47% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, tigers_fury
4:08.154 swipe_cat Fluffy_Pillow 46.9/100: 47% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, tigers_fury
4:09.924 swipe_cat Fluffy_Pillow 62.0/100: 62% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points ashamanes_energy, tigers_fury
4:10.928 rake Fluffy_Pillow 48.4/100: 48% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points tigers_fury
4:11.933 Waiting 0.100 sec 24.8/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points tigers_fury
4:12.033 wild_charge Fluffy_Pillow 25.9/100: 26% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points raid_movement, tigers_fury
4:12.033 Waiting 0.200 sec 25.9/100: 26% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points raid_movement, wild_charge_movement, tigers_fury
4:12.233 auto_attack Fluffy_Pillow 28.2/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points tigers_fury
4:12.233 Waiting 0.200 sec 28.2/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points tigers_fury
4:12.433 lunar_inspiration Fluffy_Pillow 30.5/100: 30% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points tigers_fury
4:13.438 Waiting 1.657 sec 11.9/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury
4:15.095 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury
4:16.099 Waiting 1.440 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
4:17.539 shred Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
4:18.542 Waiting 0.100 sec 39.8/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
4:18.642 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
4:19.646 Waiting 1.120 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:22.498 auto_attack Fluffy_Pillow 42.4/100: 42% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:23.066 thrash_cat Fluffy_Pillow_Add1 51.1/100: 51% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:24.070 skull_bash Fluffy_Pillow 12.5/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, scent_of_blood
4:24.070 swipe_cat Fluffy_Pillow 12.5/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, scent_of_blood
4:25.074 rip Fluffy_Pillow_Add1 35.9/100: 36% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, scent_of_blood
4:28.124 wild_charge Fluffy_Pillow 40.5/100: 40% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness
4:28.324 auto_attack Fluffy_Pillow 40.5/100: 40% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
4:28.636 swipe_cat Fluffy_Pillow 46.3/100: 46% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
4:31.174 thrash_cat Fluffy_Pillow_Add1 30.1/100: 30% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness
4:32.177 swipe_cat Fluffy_Pillow 41.4/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood
4:34.456 swipe_cat Fluffy_Pillow 34.3/100: 34% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood
4:37.252 swipe_cat Fluffy_Pillow 33.0/100: 33% energy | 704000.0/704000: 100% mana | 1.0/5: 21% combo_points clearcasting
4:38.512 swipe_cat Fluffy_Pillow 47.3/100: 47% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points
4:39.516 tigers_fury Fluffy_Pillow 13.7/100: 14% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points
4:40.027 rake Fluffy_Pillow 39.5/100: 39% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, tigers_fury
4:41.032 rip Fluffy_Pillow 35.9/100: 36% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, tigers_fury
4:42.035 lunar_inspiration Fluffy_Pillow 37.3/100: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:43.040 Waiting 0.200 sec 38.7/100: 39% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
4:43.240 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
4:44.244 wild_charge Fluffy_Pillow 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, clearcasting, predatory_swiftness, tigers_fury
4:44.244 Waiting 1.117 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, clearcasting, wild_charge_movement, predatory_swiftness, tigers_fury
4:45.361 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, tigers_fury
4:45.361 shred Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, tigers_fury
4:46.367 Waiting 0.400 sec 36.4/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
4:46.767 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
4:47.771 Waiting 1.417 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
4:49.188 skull_bash Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
4:49.188 Waiting 0.200 sec 28.4/100: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
4:49.388 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
4:52.536 auto_attack Fluffy_Pillow 35.2/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
4:53.969 thrash_cat Fluffy_Pillow_Add1 52.6/100: 53% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
4:56.765 swipe_cat Fluffy_Pillow 35.9/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood, acceleration
4:57.769 swipe_cat Fluffy_Pillow 16.5/100: 17% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, scent_of_blood, acceleration
4:59.026 swipe_cat Fluffy_Pillow 45.5/100: 46% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, acceleration
5:00.030 wild_charge Fluffy_Pillow 14.1/100: 14% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points raid_movement, predatory_swiftness, acceleration
5:00.230 auto_attack Fluffy_Pillow 14.1/100: 14% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points predatory_swiftness, acceleration
5:01.819 thrash_cat Fluffy_Pillow_Add1 38.3/100: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points clearcasting, acceleration
5:02.823 swipe_cat Fluffy_Pillow 51.9/100: 52% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points clearcasting, scent_of_blood, acceleration
5:03.829 swipe_cat Fluffy_Pillow 77.5/100: 78% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points scent_of_blood, acceleration
5:04.835 swipe_cat Fluffy_Pillow 58.1/100: 58% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points clearcasting, scent_of_blood, acceleration
5:05.840 swipe_cat Fluffy_Pillow 83.7/100: 84% energy | 704000.0/704000: 100% mana | 4.1/5: 81% combo_points acceleration
5:06.845 swipe_cat Fluffy_Pillow 50.6/100: 51% energy | 704000.0/704000: 100% mana | 4.1/5: 81% combo_points
5:09.128 rip Fluffy_Pillow 31.5/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
5:10.133 tigers_fury Fluffy_Pillow 12.9/100: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
5:10.390 rake Fluffy_Pillow 35.8/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:11.395 lunar_inspiration Fluffy_Pillow 32.2/100: 32% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:12.400 Waiting 0.600 sec 33.6/100: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:13.000 shred Fluffy_Pillow 40.4/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:14.002 Waiting 0.800 sec 31.8/100: 32% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
5:14.802 shred Fluffy_Pillow 40.8/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
5:15.808 Waiting 1.124 sec 12.2/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
5:16.932 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
5:16.932 Waiting 1.400 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
5:18.332 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
5:19.337 Waiting 4.121 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
5:23.458 ferocious_bite Fluffy_Pillow 59.0/100: 59% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting
5:24.462 rake Fluffy_Pillow 45.4/100: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
5:25.467 Waiting 0.781 sec 21.8/100: 22% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:26.248 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:27.252 Waiting 2.540 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:29.792 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:30.796 skull_bash Fluffy_Pillow 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:30.796 Waiting 1.223 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:32.019 wild_charge Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, predatory_swiftness
5:32.019 Waiting 0.200 sec 26.1/100: 26% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, wild_charge_movement, predatory_swiftness
5:32.219 auto_attack Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:32.219 Waiting 1.100 sec 28.4/100: 28% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:33.319 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:34.323 Waiting 1.122 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
5:36.467 rake Fluffy_Pillow 36.6/100: 37% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points
5:37.471 Waiting 1.159 sec 13.0/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
5:38.630 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting
5:39.635 Waiting 1.099 sec 12.5/100: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
5:40.734 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
5:40.734 lunar_inspiration Fluffy_Pillow 45.0/100: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:41.739 shred Fluffy_Pillow 46.4/100: 46% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:42.743 Waiting 0.200 sec 37.8/100: 38% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:42.943 shred Fluffy_Pillow 40.0/100: 40% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:43.946 Waiting 0.800 sec 31.4/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
5:44.746 shred Fluffy_Pillow 40.5/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
5:45.753 Waiting 1.652 sec 11.9/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
5:47.405 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
5:48.409 Waiting 1.141 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness, tigers_fury
5:49.550 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
5:50.572 rake Fluffy_Pillow 36.6/100: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
5:51.578 lunar_inspiration Fluffy_Pillow 13.0/100: 13% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness
5:52.580 shred Fluffy_Pillow 24.4/100: 24% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness
5:53.585 Waiting 4.700 sec 35.8/100: 36% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
5:58.285 ferocious_bite Fluffy_Pillow 89.1/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
5:59.291 shred Fluffy_Pillow 50.5/100: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
6:00.295 Waiting 0.375 sec 21.9/100: 22% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
6:01.692 rake Fluffy_Pillow 37.7/100: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
6:02.696 Waiting 1.359 sec 14.1/100: 14% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
6:04.055 wild_charge Fluffy_Pillow 29.5/100: 30% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness
6:04.055 Waiting 0.200 sec 29.5/100: 30% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, wild_charge_movement, predatory_swiftness
6:04.255 auto_attack Fluffy_Pillow 31.8/100: 32% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
6:04.255 Waiting 0.300 sec 31.8/100: 32% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
6:04.555 lunar_inspiration Fluffy_Pillow 35.2/100: 35% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
6:05.559 Waiting 1.641 sec 16.6/100: 17% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
6:07.200 incarnation Fluffy_Pillow 35.2/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
6:07.200 potion Fluffy_Pillow 35.2/150: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
6:07.200 ferocious_bite Fluffy_Pillow 35.2/150: 23% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:08.204 shred Fluffy_Pillow 21.6/150: 14% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:09.209 Waiting 1.058 sec 13.0/150: 9% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:10.267 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:11.270 skull_bash Fluffy_Pillow 16.4/150: 11% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:11.270 tigers_fury Fluffy_Pillow 16.4/150: 11% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:11.270 shred Fluffy_Pillow 36.4/150: 24% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:12.274 ferocious_bite Fluffy_Pillow 47.8/150: 32% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:13.277 rake Fluffy_Pillow 54.1/150: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:14.281 shred Fluffy_Pillow 68.0/150: 45% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:15.287 shred Fluffy_Pillow 59.4/150: 40% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:16.291 ferocious_bite Fluffy_Pillow 50.8/150: 34% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:17.295 shred Fluffy_Pillow 37.2/150: 25% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:18.300 shred Fluffy_Pillow 28.6/150: 19% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:19.306 lunar_inspiration Fluffy_Pillow 20.0/150: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:20.312 dash Fluffy_Pillow 16.4/150: 11% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:20.312 Waiting 0.754 sec 16.4/150: 11% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, dash, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:21.066 auto_attack Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:21.066 Waiting 0.100 sec 25.0/150: 17% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:21.166 ferocious_bite Fluffy_Pillow 26.1/150: 17% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:22.169 Waiting 1.101 sec 12.5/150: 8% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:23.270 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:24.530 rake Fluffy_Pillow 19.3/150: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:25.535 Waiting 1.041 sec 13.2/150: 9% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:26.576 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:27.580 Waiting 0.859 sec 16.4/150: 11% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:28.439 ferocious_bite Fluffy_Pillow 26.1/150: 17% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:29.445 Waiting 1.098 sec 12.5/150: 8% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:30.543 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:31.545 Waiting 0.761 sec 16.4/150: 11% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:32.306 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
6:33.313 lunar_inspiration Fluffy_Pillow 16.4/150: 11% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, dash, incarnation_king_of_the_jungle, predatory_swiftness
6:34.318 ferocious_bite Fluffy_Pillow 27.8/150: 19% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
6:35.832 rake Fluffy_Pillow 20.0/150: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, predatory_swiftness
6:36.832 auto_attack Fluffy_Pillow 2.5/150: 2% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, predatory_swiftness
6:36.838 Waiting 2.378 sec 13.9/150: 9% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, predatory_swiftness
6:39.216 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
6:40.221 Waiting 1.121 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
6:41.342 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
6:41.342 shred Fluffy_Pillow 45.0/100: 45% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
6:42.346 Waiting 2.000 sec 36.4/100: 36% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
6:44.346 ferocious_bite Fluffy_Pillow 99.1/100: 99% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
6:45.351 shred Fluffy_Pillow 60.5/100: 60% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, tigers_fury
6:46.867 rake Fluffy_Pillow 37.7/100: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
6:47.873 Waiting 2.363 sec 14.1/100: 14% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
6:50.236 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
6:51.241 skull_bash Fluffy_Pillow 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
6:51.241 Waiting 1.121 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 25276 23570 13420 (11866)
Stamina 35555 35555 21306
Intellect 7651 7326 0
Spirit 0 0 0
Health 2133300 2133300 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 30331 28284 0
Crit 31.97% 31.97% 5938
Haste 13.43% 13.43% 4366
Damage / Heal Versatility 5.70% 5.70% 2279
Attack Power 25276 23570 0
Mastery 65.42% 63.26% 8272
Armor 2137 2137 2137
Run Speed 10 0 0
Leech 1.76% 1.76% 404

Gear

Source Slot Average Item Level: 860.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Strand of the Stars
ilevel: 840, stats: { +997 Sta, +960 Vers, +808 Mastery }
Local Shoulders Otherworldy Leather Mantle
ilevel: 865, stats: { 259 Armor, +1678 Sta, +1119 AgiInt, +628 Crit, +407 Mastery }
Local Chest Ekowraith, Creator of Worlds
ilevel: 895, stats: { 382 Armor, +2959 Sta, +1973 AgiInt, +552 Crit, +993 Mastery }
Local Waist Swordsinger's Belt
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +628 Mastery, +407 Haste, +638 unknown }
Local Legs Felbat Leather Leggings
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +792 Crit, +512 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 875, stats: { 246 Armor, +1842 Sta, +1228 AgiInt, +744 Mastery, +330 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Raven's Veil Gloves
ilevel: 855, stats: { 209 Armor, +1019 AgiInt, +1529 Sta, +627 Mastery, +370 Crit }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +150 Mastery }
Local Finger2 Mindrend Band
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Haste }, enchant: { +150 Mastery }
Local Trinket1 Chrono Shard
ilevel: 840, stats: { +1123 StrAgiInt, +404 Leech }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Nightborne Noble's Cloak
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +483 Mastery, +237 Haste }, gems: { +150 Mastery }, enchant: { +150 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 875, weapon: { 2879 - 5349, 1.8 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }, relics: { +40 ilevels, +42 ilevels, +43 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 875, weapon: { 2879 - 5349, 1.8 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="Oinkie"
origin="https://us.api.battle.net/wow/character/thrall/Oinkie/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/231/133784295-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=inscription=713/herbalism=815
talents=3311222
artifact=58:0:0:0:0:1153:1:1154:1:1156:1:1157:1:1158:1:1161:3:1162:3:1163:3:1164:3:1165:3:1166:3:1167:2:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener=tigers_fury,if=!dot.rip.ticking&combo_points=5

head=biornskin_hood,id=134196,bonus_id=3414/1527/3336
neck=strand_of_the_stars,id=137487,bonus_id=1727/1492/1813
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1805/1487
back=nightborne_nobles_cloak,id=134290,bonus_id=3397/1808/1507/3337,gems=150mastery,enchant=150agi
chest=ekowraith_creator_of_worlds,id=137015,bonus_id=1811
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=ravens_veil_gloves,id=139242,bonus_id=3411/1507/3336
waist=swordsingers_belt,id=134287,bonus_id=3413/43/1527/3337
legs=felbat_leather_leggings,id=134370,bonus_id=1727/1512/3336
feet=manatanned_sandals,id=141430,bonus_id=1487/3337
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1727/1492/1813,enchant=150mastery
finger2=mindrend_band,id=138220,bonus_id=1807/1472,enchant=150mastery
trinket1=chrono_shard,id=137419,bonus_id=1727/41/1492/1813
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/133687/139249/0,relic_id=1727:1492:1813/1727:1497:3336/1807:1472/0
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=859.69
# gear_agility=13420
# gear_stamina=21306
# gear_crit_rating=5938
# gear_haste_rating=3638
# gear_mastery_rating=8272
# gear_versatility_rating=2279
# gear_leech_rating=404
# gear_armor=2137
# set_bonus=journey_through_time_2pc=1

Rothlandra

Rothlandra : 408220 dps, 247860 dps to main target

  • Race: Blood Elf
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
408219.7 408219.7 549.4 / 0.135% 107676.6 / 26.4% 24181.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.8 16.8 Focus 12.26% 36.8 100.0% 95%
Origin https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Posthaste
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • mining: 238
  • herbalism: 260
Scale Factors for Rothlandra Damage Per Second
Mastery Haste Agi Vers Crit
Scale Factors 13.02 12.33 11.54 10.12 9.43
Normalized 1.13 1.07 1.00 0.88 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.69 0.69 0.69 0.69 0.69
Gear Ranking
Optimizers
Ranking
  • Mastery ~= Haste > Agi > Vers ~= Crit
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.54, CritRating=9.43, HasteRating=12.33, MasteryRating=13.02, Versatility=10.12 )

Scale Factors for other metrics

Scale Factors for Rothlandra Damage Per Second
Mastery Haste Agi Vers Crit
Scale Factors 13.02 12.33 11.54 10.12 9.43
Normalized 1.13 1.07 1.00 0.88 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.69 0.69 0.69 0.69 0.69
Gear Ranking
Optimizers
Ranking
  • Mastery ~= Haste > Agi > Vers ~= Crit
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.54, CritRating=9.43, HasteRating=12.33, MasteryRating=13.02, Versatility=10.12 )
Scale Factors for Rothlandra Priority Target Damage Per Second
Mastery Haste Agi Vers Crit
Scale Factors 8.26 7.93 6.70 6.23 5.82
Normalized 1.23 1.18 1.00 0.93 0.87
Scale Deltas 1138 1138 1138 1138 1138
Error 0.24 0.24 0.24 0.24 0.24
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste > Agi > Vers > Crit
Pawn string ( Pawn: v1: "Rothlandra": Agility=6.70, CritRating=5.82, HasteRating=7.93, MasteryRating=8.26, Versatility=6.23 )
Scale Factors for Rothlandra Damage Per Second (Effective)
Mastery Haste Agi Vers Crit
Scale Factors 13.02 12.33 11.54 10.12 9.43
Normalized 1.13 1.07 1.00 0.88 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste > Agi > Vers > Crit
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.54, CritRating=9.43, HasteRating=12.33, MasteryRating=13.02, Versatility=10.12 )
Scale Factors for Rothlandra Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for RothlandraTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rothlandra 408220
Aimed Shot 96130 (112783) 23.7% (27.8%) 107.3 3.71sec 421531 265771 Direct 107.2 230112 541629 359655 41.6%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.33 107.22 0.00 0.00 1.5861 0.0000 38562731.02 56690867.35 31.98 265770.87 265770.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.64 58.42% 230112.10 101891 254728 229996.54 199391 252093 14413358 21189001 31.98
crit 44.59 41.58% 541628.52 213972 815131 541216.11 426434 632277 24149373 35501866 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 16653 4.1% 0.0 0.00sec 0 0 Direct 95.9 44606 105077 69646 41.4%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 95.94 0.00 0.00 0.0000 0.0000 6681569.67 9822540.31 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.21 58.59% 44606.08 19979 49947 44621.51 24260 49947 2507314 3685989 31.98
crit 39.73 41.41% 105076.65 41955 159830 104887.21 53328 143805 4174256 6136552 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 13801 3.4% 152.1 2.64sec 36365 13836 Direct 152.1 26010 55808 36365 34.8%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 152.06 152.06 0.00 0.00 2.6283 0.0000 5529831.14 8129375.57 31.98 13836.30 13836.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.22 65.25% 26010.16 26010 26010 26010.16 26010 26010 2580726 3793911 31.98
crit 52.84 34.75% 55808.49 52020 78030 55806.02 52020 60474 2949105 4335464 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 81236 19.8% 19.3 21.27sec 1668183 645485 Periodic 1036.1 22726 48291 31146 32.9% 11.3%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.34 0.00 295.02 1036.06 2.5844 0.1530 32269064.26 47438581.07 31.98 645484.56 645484.56
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 694.8 67.06% 22726.01 17838 35676 22715.11 21299 24555 15790574 23213640 31.98
crit 341.2 32.94% 48290.88 35676 107029 48317.05 42256 54238 16478490 24224941 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 8580 2.1% 30.9 3.61sec 109831 0 Direct 30.7 79173 184330 110258 29.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.86 30.74 0.00 0.00 0.0000 0.0000 3389568.82 3389568.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.66 70.44% 79173.00 79173 79173 79173.00 79173 79173 1714528 1714528 0.00
crit 9.09 29.56% 184330.26 158346 237519 184300.64 158346 237519 1675041 1675041 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 117163 28.6% 34.7 11.59sec 1340399 1122707 Direct 109.5 304753 644275 424043 35.1%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.65 109.54 0.00 0.00 1.1939 0.0000 46449743.79 68285523.22 31.98 1122706.69 1122706.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.05 64.87% 304752.74 122637 306593 304749.04 284518 306593 21654117 31833604 31.98
crit 38.49 35.13% 644274.56 245274 919778 644468.29 560228 740051 24795626 36451919 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Pepper Breath 3923 1.0% 18.9 21.10sec 83355 0 Periodic 92.6 16975 0 16975 0.0% 5.8%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.86 0.00 93.79 92.63 0.0000 0.2498 1572377.85 1572377.85 0.00 67121.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.6 100.00% 16975.36 68 16990 16976.03 16558 16990 1572378 1572378 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Sidewinders 50608 12.3% 42.6 9.46sec 471211 390943 Direct 144.9 102802 215232 138439 31.7%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.58 144.94 0.00 0.00 1.2053 0.0000 20065527.54 20065527.54 0.00 390942.75 390942.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.00 68.30% 102801.60 102802 102802 102801.60 102802 102802 10177235 10177235 0.00
crit 45.94 31.70% 215232.00 205603 308405 215240.02 205603 237234 9888293 9888293 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 20127 5.0% 15.5 25.00sec 520176 388293 Direct 16.5 356762 742530 489688 34.5%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.52 16.48 0.00 0.00 1.3397 0.0000 8071449.08 11865794.69 31.98 388293.12 388293.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.80 65.54% 356762.34 356762 356762 356762.34 356762 356762 3854275 5666149 31.98
crit 5.68 34.46% 742530.10 713525 1070287 741341.39 0 1070287 4217174 6199645 31.95
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Rothlandra
Arcane Torrent 4.8 91.02sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:80483
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
Spelldata
  • id:80483
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=15} of your Focus. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.8 181.25sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:170.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 21.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 7.1 273.7 44.9sec 1.3sec 30.09% 30.09% 165.3(165.3) 6.1

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.17%
  • bullseye_2:0.18%
  • bullseye_3:0.16%
  • bullseye_4:0.15%
  • bullseye_5:4.49%
  • bullseye_6:0.13%
  • bullseye_7:0.12%
  • bullseye_8:0.12%
  • bullseye_9:0.12%
  • bullseye_10:2.87%
  • bullseye_11:0.12%
  • bullseye_12:0.11%
  • bullseye_13:0.11%
  • bullseye_14:0.11%
  • bullseye_15:0.40%
  • bullseye_16:0.10%
  • bullseye_17:0.10%
  • bullseye_18:0.10%
  • bullseye_19:0.10%
  • bullseye_20:0.42%
  • bullseye_21:0.10%
  • bullseye_22:0.11%
  • bullseye_23:0.11%
  • bullseye_24:0.11%
  • bullseye_25:0.45%
  • bullseye_26:0.11%
  • bullseye_27:0.11%
  • bullseye_28:0.12%
  • bullseye_29:0.12%
  • bullseye_30:18.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 11.6 0.6 32.7sec 31.0sec 8.61% 10.98% 0.6(0.7) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.57%
  • lock_and_load_2:4.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 33.8 12.6 12.0sec 8.7sec 40.97% 49.91% 12.6(12.6) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:40.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 78.0sec 0.0sec 14.68% 14.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 2.8 0.0 180.1sec 181.3sec 10.14% 11.02% 0.0(0.0) 2.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.8 0.0 180.1sec 181.3sec 10.14% 15.05% 0.0(0.0) 2.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rothlandra
aimed_shot Focus 107.3 4193.3 39.1 39.1 10789.7
barrage Focus 19.3 1160.6 60.0 60.0 27803.3
marked_shot Focus 34.7 1039.6 30.0 30.0 44678.4
windburst Focus 16.5 330.3 20.0 21.3 24434.1
Resource Gains Type Count Total Average Overflow
arcane_torrent Focus 4.84 71.85 (1.08%) 14.85 0.75 1.03%
sidewinders Focus 42.58 1990.45 (29.93%) 46.74 138.70 6.51%
focus_regen Focus 1381.60 4588.90 (68.99%) 3.32 394.43 7.92%
Resource RPS-Gain RPS-Loss
Focus 16.59 16.77
Combat End Resource Mean Min Max
Focus 77.70 1.97 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 6.5%

Procs

Count Interval
starved: barrage 97.9 5.3sec
lock_and_load 12.1 31.0sec
no_vuln_aimed_shot 12.6 25.4sec
no_vuln_marked_shot 5.8 55.7sec
marking_targets 46.4 8.7sec
wasted_marking_targets 12.6 29.6sec

Statistics & Data Analysis

Fight Length
Sample Data Rothlandra Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Rothlandra Damage Per Second
Count 9999
Mean 408219.72
Minimum 325700.80
Maximum 529017.94
Spread ( max - min ) 203317.14
Range [ ( max - min ) / 2 * 100% ] 24.90%
Standard Deviation 28031.0386
5th Percentile 365735.54
95th Percentile 456709.80
( 95th Percentile - 5th Percentile ) 90974.26
Mean Distribution
Standard Deviation 280.3244
95.00% Confidence Intervall ( 407670.29 - 408769.14 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 181
0.1% Error 18112
0.1 Scale Factor Error with Delta=300 6707521
0.05 Scale Factor Error with Delta=300 26830084
0.01 Scale Factor Error with Delta=300 670752109
Priority Target DPS
Sample Data Rothlandra Priority Target Damage Per Second
Count 9999
Mean 247859.69
Minimum 214261.44
Maximum 291074.90
Spread ( max - min ) 76813.46
Range [ ( max - min ) / 2 * 100% ] 15.50%
Standard Deviation 9884.0580
5th Percentile 231908.04
95th Percentile 264725.89
( 95th Percentile - 5th Percentile ) 32817.85
Mean Distribution
Standard Deviation 98.8455
95.00% Confidence Intervall ( 247665.95 - 248053.42 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6108
0.1 Scale Factor Error with Delta=300 833977
0.05 Scale Factor Error with Delta=300 3335909
0.01 Scale Factor Error with Delta=300 83397731
DPS(e)
Sample Data Rothlandra Damage Per Second (Effective)
Count 9999
Mean 408219.72
Minimum 325700.80
Maximum 529017.94
Spread ( max - min ) 203317.14
Range [ ( max - min ) / 2 * 100% ] 24.90%
Damage
Sample Data Rothlandra Damage
Count 9999
Mean 162591863.17
Minimum 125955336.55
Maximum 197728509.63
Spread ( max - min ) 71773173.08
Range [ ( max - min ) / 2 * 100% ] 22.07%
DTPS
Sample Data Rothlandra Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rothlandra Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rothlandra Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rothlandra Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rothlandra Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rothlandra Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RothlandraTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rothlandra Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 0.98 auto_shot
8 4.84 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
0.00 blood_fury
0.00 berserking
9 0.02 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
A 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
B 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
C 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
D 12.19 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
E 6.23 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
F 17.53 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
G 0.03 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
H 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
I 9.92 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
J 0.45 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
K 20.21 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
L 31.16 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
M 71.36 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
N 9.28 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
O 1.08 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
P 29.09 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
Q 10.08 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
R 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
S 1.80 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
T 0.95 trueshot
U 1.45 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
V 2.93 marked_shot
W 1.22 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
X 0.93 barrage
Y 6.71 aimed_shot,if=execute_time<debuff.vulnerability.remains
Z 1.48 sidewinders
a 0.28 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
b 0.71 marked_shot
c 0.01 windburst
d 1.22 aimed_shot,if=execute_time<debuff.vulnerability.remains
e 0.64 sidewinders
f 0.22 aimed_shot
0.00 arcane_shot

Sample Sequence

04567TXYUVY8YYYUVUVYYWYPLLLKDFMLMIKMMMMPKMMMMDIFLLKPNMMPRLKMDIFMMMPLLKDQPFKMMQ8LIMDILNFMMMIMDLQPKMFMPLKMMDPKMMFMMMPLLQNSDIKMMMFMIKMMMP8KMDPLLNFQQPKMDQPMMMQFMPLKDLLQPKMLFMMMDIMMPKMMPKMFDM8PKMMQQPKDFMMMPKMMPNMMDFPLLOMMPLLNDMFSPLLLLNMMMINMMMDGILL8MNMIMMPLEFLLNMIMMPLENFded

Sample Sequence Table

time name target resources buffs
Pre flask Rothlandra 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Rothlandra 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus rapid_killing, trueshot, potion_of_deadly_grace
0:02.094 aimed_shot Fluffy_Pillow 109.3/150: 73% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.048 sidewinders Fluffy_Pillow 79.4/150: 53% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.803 marked_shot Fluffy_Pillow 145.4/150: 97% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:04.559 aimed_shot Fluffy_Pillow 131.3/150: 88% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:05.513 arcane_torrent Fluffy_Pillow 100.1/150: 67% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:05.513 aimed_shot Fluffy_Pillow 115.1/150: 77% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:06.467 aimed_shot Fluffy_Pillow 85.2/150: 57% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:07.420 aimed_shot Fluffy_Pillow 55.3/150: 37% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:08.374 sidewinders Fluffy_Pillow 25.4/150: 17% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:09.129 marked_shot Fluffy_Pillow 91.3/150: 61% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:09.883 sidewinders Fluffy_Pillow 77.2/150: 51% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:10.638 marked_shot Fluffy_Pillow 143.1/150: 95% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:11.392 aimed_shot Fluffy_Pillow 129.0/150: 86% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:12.145 Waiting 1.000 sec 144.9/150: 97% focus bloodlust, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:13.145 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.099 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, lock_and_load, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.854 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:15.807 sidewinders Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets, potion_of_deadly_grace
0:16.805 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, potion_of_deadly_grace
0:18.139 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, potion_of_deadly_grace
0:19.471 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bloodlust, potion_of_deadly_grace
0:20.471 marked_shot Fluffy_Pillow 85.2/150: 57% focus bloodlust, raid_movement, potion_of_deadly_grace
0:21.472 barrage Fluffy_Pillow 70.3/150: 47% focus bloodlust, raid_movement, lock_and_load(2), potion_of_deadly_grace
0:23.719 windburst Fluffy_Pillow 44.1/150: 29% focus bloodlust, lock_and_load(2), potion_of_deadly_grace
0:24.721 aimed_shot Fluffy_Pillow 39.2/150: 26% focus bloodlust, lock_and_load(2), marking_targets, potion_of_deadly_grace
0:25.720 aimed_shot Fluffy_Pillow 54.2/150: 36% focus bloodlust, lock_and_load, marking_targets, potion_of_deadly_grace
0:26.721 aimed_shot Fluffy_Pillow 69.3/150: 46% focus bloodlust, marking_targets, potion_of_deadly_grace
0:28.005 sidewinders Fluffy_Pillow 88.6/150: 59% focus bloodlust, raid_movement, marking_targets
0:29.005 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, raid_movement
0:30.004 aimed_shot Fluffy_Pillow 135.0/150: 90% focus bloodlust, lock_and_load(2), marking_targets
0:31.007 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, lock_and_load, marking_targets
0:32.008 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets
0:33.339 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bloodlust, marking_targets
0:34.670 sidewinders Fluffy_Pillow 70.1/150: 47% focus bloodlust, marking_targets
0:35.671 marked_shot Fluffy_Pillow 135.1/150: 90% focus bloodlust
0:36.671 aimed_shot Fluffy_Pillow 120.2/150: 80% focus bloodlust, marking_targets
0:38.003 aimed_shot Fluffy_Pillow 140.2/150: 93% focus bloodlust, lock_and_load, marking_targets
0:39.004 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets
0:40.337 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets
0:41.671 barrage Fluffy_Pillow 65.5/150: 44% focus marking_targets
0:44.485 sidewinders Fluffy_Pillow 38.1/150: 25% focus raid_movement, marking_targets
0:45.784 windburst Fluffy_Pillow 103.1/150: 69% focus marking_targets
0:47.083 aimed_shot Fluffy_Pillow 98.2/150: 65% focus marking_targets
0:48.815 aimed_shot Fluffy_Pillow 68.2/150: 45% focus marking_targets
0:50.114 marked_shot Fluffy_Pillow 83.3/150: 56% focus raid_movement, marking_targets
0:51.413 sidewinders Fluffy_Pillow 68.3/150: 46% focus raid_movement, marking_targets
0:52.712 marked_shot Fluffy_Pillow 133.4/150: 89% focus raid_movement, marking_targets
0:54.012 aimed_shot Fluffy_Pillow 118.4/150: 79% focus marking_targets
0:55.744 aimed_shot Fluffy_Pillow 88.5/150: 59% focus marking_targets
0:57.475 sidewinders Fluffy_Pillow 58.5/150: 39% focus marking_targets
0:58.773 potion Fluffy_Pillow 123.5/150: 82% focus
0:58.773 aimed_shot Fluffy_Pillow 123.5/150: 82% focus potion_of_deadly_grace
1:00.073 marked_shot Fluffy_Pillow 138.6/150: 92% focus raid_movement, potion_of_deadly_grace
1:01.372 aimed_shot Fluffy_Pillow 123.6/150: 82% focus potion_of_deadly_grace
1:03.104 barrage Fluffy_Pillow 93.7/150: 62% focus potion_of_deadly_grace
1:05.923 Waiting 0.500 sec 66.3/150: 44% focus potion_of_deadly_grace
1:06.423 sidewinders Fluffy_Pillow 72.1/150: 48% focus potion_of_deadly_grace
1:07.724 windburst Fluffy_Pillow 137.2/150: 91% focus bullseye(5), potion_of_deadly_grace
1:09.022 aimed_shot Fluffy_Pillow 130.0/150: 87% focus bullseye(5), marking_targets, potion_of_deadly_grace
1:10.753 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bullseye(5), marking_targets, potion_of_deadly_grace
1:12.483 aimed_shot Fluffy_Pillow 70.1/150: 47% focus marking_targets, potion_of_deadly_grace
1:14.213 Waiting 1.200 sec 40.1/150: 27% focus marking_targets, potion_of_deadly_grace
1:15.413 sidewinders Fluffy_Pillow 54.0/150: 36% focus marking_targets, potion_of_deadly_grace
1:16.878 Waiting 0.300 sec 121.0/150: 81% focus raid_movement, potion_of_deadly_grace
1:17.178 aimed_shot Fluffy_Pillow 124.4/150: 83% focus potion_of_deadly_grace
1:18.911 aimed_shot Fluffy_Pillow 94.5/150: 63% focus potion_of_deadly_grace
1:20.210 marked_shot Fluffy_Pillow 109.5/150: 73% focus raid_movement, potion_of_deadly_grace
1:21.510 Waiting 1.400 sec 94.6/150: 63% focus raid_movement, potion_of_deadly_grace
1:22.910 barrage Fluffy_Pillow 110.8/150: 74% focus raid_movement, marking_targets, potion_of_deadly_grace
1:25.927 Waiting 0.200 sec 85.7/150: 57% focus marking_targets, potion_of_deadly_grace
1:26.127 aimed_shot Fluffy_Pillow 88.0/150: 59% focus marking_targets, potion_of_deadly_grace
1:27.857 sidewinders Fluffy_Pillow 58.1/150: 39% focus marking_targets, potion_of_deadly_grace
1:29.156 windburst Fluffy_Pillow 123.1/150: 82% focus
1:30.456 marked_shot Fluffy_Pillow 118.2/150: 79% focus
1:31.755 aimed_shot Fluffy_Pillow 103.2/150: 69% focus
1:33.053 Waiting 0.100 sec 118.2/150: 79% focus raid_movement
1:33.153 aimed_shot Fluffy_Pillow 119.4/150: 80% focus
1:34.883 Waiting 0.300 sec 89.4/150: 60% focus
1:35.183 aimed_shot Fluffy_Pillow 92.9/150: 62% focus
1:36.914 arcane_torrent Fluffy_Pillow 62.9/150: 42% focus
1:36.914 aimed_shot Fluffy_Pillow 77.9/150: 52% focus
1:38.646 Waiting 2.700 sec 48.0/150: 32% focus
1:41.346 sidewinders Fluffy_Pillow 79.2/150: 53% focus
1:42.646 aimed_shot Fluffy_Pillow 144.3/150: 96% focus marking_targets
1:44.379 barrage Fluffy_Pillow 100.1/150: 67% focus marking_targets
1:47.090 sidewinders Fluffy_Pillow 71.5/150: 48% focus marking_targets
1:48.390 Waiting 0.800 sec 136.5/150: 91% focus raid_movement
1:49.190 aimed_shot Fluffy_Pillow 145.8/150: 97% focus
1:50.490 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement
1:51.790 Waiting 1.800 sec 135.1/150: 90% focus raid_movement
1:53.590 windburst Fluffy_Pillow 150.0/150: 100% focus
1:54.887 aimed_shot Fluffy_Pillow 130.0/150: 87% focus
1:56.618 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
1:58.350 aimed_shot Fluffy_Pillow 70.1/150: 47% focus
2:00.081 Waiting 1.800 sec 40.1/150: 27% focus
2:01.881 sidewinders Fluffy_Pillow 61.0/150: 41% focus
2:03.181 aimed_shot Fluffy_Pillow 126.0/150: 84% focus marking_targets
2:04.481 barrage Fluffy_Pillow 141.1/150: 94% focus raid_movement, marking_targets
2:07.170 Waiting 0.100 sec 112.2/150: 75% focus bullseye(30), marking_targets
2:07.270 aimed_shot Fluffy_Pillow 113.4/150: 76% focus bullseye(30), marking_targets
2:09.001 aimed_shot Fluffy_Pillow 83.4/150: 56% focus bullseye(30), marking_targets
2:10.733 sidewinders Fluffy_Pillow 53.5/150: 36% focus bullseye(30), marking_targets
2:12.034 marked_shot Fluffy_Pillow 118.5/150: 79% focus bullseye(30)
2:13.333 aimed_shot Fluffy_Pillow 103.6/150: 69% focus
2:15.064 windburst Fluffy_Pillow 73.6/150: 49% focus
2:16.363 aimed_shot Fluffy_Pillow 68.7/150: 46% focus marking_targets
2:18.093 sidewinders Fluffy_Pillow 38.7/150: 26% focus marking_targets
2:19.393 aimed_shot Fluffy_Pillow 103.7/150: 69% focus
2:20.691 marked_shot Fluffy_Pillow 118.8/150: 79% focus marking_targets
2:21.990 Waiting 0.100 sec 103.8/150: 69% focus marking_targets
2:22.090 aimed_shot Fluffy_Pillow 105.0/150: 70% focus marking_targets
2:23.822 aimed_shot Fluffy_Pillow 75.0/150: 50% focus marking_targets
2:25.556 Waiting 1.400 sec 45.1/150: 30% focus marking_targets
2:26.956 barrage Fluffy_Pillow 61.3/150: 41% focus marking_targets
2:29.836 sidewinders Fluffy_Pillow 34.6/150: 23% focus marking_targets
2:31.135 marked_shot Fluffy_Pillow 99.7/150: 66% focus
2:32.434 aimed_shot Fluffy_Pillow 84.7/150: 56% focus
2:34.167 aimed_shot Fluffy_Pillow 54.8/150: 37% focus
2:35.897 Waiting 1.500 sec 74.8/150: 50% focus lock_and_load
2:37.397 windburst Fluffy_Pillow 92.2/150: 61% focus lock_and_load
2:38.697 aimed_shot Fluffy_Pillow 87.2/150: 58% focus lock_and_load
2:39.996 aimed_shot Fluffy_Pillow 102.3/150: 68% focus
2:41.728 aimed_shot Fluffy_Pillow 72.3/150: 48% focus
2:43.459 sidewinders Fluffy_Pillow 42.4/150: 28% focus marking_targets
2:44.757 aimed_shot Fluffy_Pillow 107.4/150: 72% focus
2:46.488 aimed_shot Fluffy_Pillow 77.4/150: 52% focus
2:48.218 Waiting 0.200 sec 97.5/150: 65% focus lock_and_load, marking_targets
2:48.418 aimed_shot Fluffy_Pillow 99.8/150: 67% focus lock_and_load, marking_targets
2:49.718 marked_shot Fluffy_Pillow 114.8/150: 77% focus marking_targets
2:51.018 trueshot Fluffy_Pillow 99.9/150: 67% focus raid_movement, marking_targets
2:51.018 Waiting 0.100 sec 99.9/150: 67% focus raid_movement, marking_targets, rapid_killing, trueshot
2:51.118 barrage Fluffy_Pillow 101.5/150: 68% focus raid_movement, marking_targets, rapid_killing, trueshot
2:53.283 sidewinders Fluffy_Pillow 76.6/150: 51% focus marking_targets, rapid_killing, trueshot
2:54.215 marked_shot Fluffy_Pillow 141.7/150: 94% focus rapid_killing, trueshot
2:55.144 aimed_shot Fluffy_Pillow 126.8/150: 85% focus rapid_killing, trueshot
2:56.382 aimed_shot Fluffy_Pillow 146.8/150: 98% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:57.312 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets, rapid_killing, trueshot
2:58.548 windburst Fluffy_Pillow 100.0/150: 67% focus marking_targets, rapid_killing, trueshot
2:59.622 aimed_shot Fluffy_Pillow 97.5/150: 65% focus marking_targets, rapid_killing, trueshot
3:00.860 sidewinders Fluffy_Pillow 67.5/150: 45% focus marking_targets, rapid_killing, trueshot
3:01.790 marked_shot Fluffy_Pillow 132.6/150: 88% focus marking_targets, rapid_killing, trueshot
3:02.718 aimed_shot Fluffy_Pillow 117.6/150: 78% focus marking_targets, rapid_killing, trueshot
3:03.956 aimed_shot Fluffy_Pillow 87.7/150: 58% focus marking_targets, rapid_killing, trueshot
3:05.192 aimed_shot Fluffy_Pillow 57.7/150: 38% focus marking_targets, rapid_killing, trueshot
3:06.429 sidewinders Fluffy_Pillow 25.9/150: 17% focus marking_targets
3:07.921 arcane_torrent Fluffy_Pillow 93.2/150: 62% focus bullseye(5)
3:07.921 marked_shot Fluffy_Pillow 108.2/150: 72% focus bullseye(5)
3:09.220 aimed_shot Fluffy_Pillow 93.2/150: 62% focus bullseye(10), marking_targets
3:10.951 barrage Fluffy_Pillow 63.2/150: 42% focus bullseye(10), marking_targets
3:13.944 sidewinders Fluffy_Pillow 37.9/150: 25% focus marking_targets
3:15.324 aimed_shot Fluffy_Pillow 103.9/150: 69% focus
3:17.054 aimed_shot Fluffy_Pillow 73.9/150: 49% focus
3:18.786 Waiting 0.300 sec 44.0/150: 29% focus
3:19.086 marked_shot Fluffy_Pillow 47.4/150: 32% focus
3:20.385 Waiting 3.200 sec 32.5/150: 22% focus raid_movement, lock_and_load(2)
3:23.585 windburst Fluffy_Pillow 69.5/150: 46% focus lock_and_load(2)
3:24.885 Waiting 0.300 sec 84.6/150: 56% focus raid_movement, lock_and_load(2)
3:25.185 aimed_shot Fluffy_Pillow 88.0/150: 59% focus lock_and_load(2)
3:26.485 aimed_shot Fluffy_Pillow 103.1/150: 69% focus lock_and_load
3:27.786 sidewinders Fluffy_Pillow 118.2/150: 79% focus marking_targets
3:29.087 marked_shot Fluffy_Pillow 150.0/150: 100% focus
3:30.387 Waiting 0.200 sec 135.1/150: 90% focus
3:30.587 aimed_shot Fluffy_Pillow 137.4/150: 92% focus
3:32.318 barrage Fluffy_Pillow 100.0/150: 67% focus
3:35.132 Waiting 0.500 sec 72.6/150: 48% focus
3:35.632 aimed_shot Fluffy_Pillow 78.4/150: 52% focus
3:37.364 sidewinders Fluffy_Pillow 48.5/150: 32% focus
3:38.663 aimed_shot Fluffy_Pillow 113.5/150: 76% focus bullseye(5), lock_and_load(2)
3:39.963 aimed_shot Fluffy_Pillow 128.6/150: 86% focus bullseye(5), lock_and_load
3:41.263 aimed_shot Fluffy_Pillow 143.6/150: 96% focus bullseye(5)
3:42.993 Waiting 0.200 sec 100.0/150: 67% focus bullseye(5)
3:43.193 aimed_shot Fluffy_Pillow 102.4/150: 68% focus bullseye(5), marking_targets
3:44.924 windburst Fluffy_Pillow 72.4/150: 48% focus marking_targets
3:46.223 aimed_shot Fluffy_Pillow 67.4/150: 45% focus marking_targets
3:47.954 sidewinders Fluffy_Pillow 37.5/150: 25% focus marking_targets
3:49.253 aimed_shot Fluffy_Pillow 102.5/150: 68% focus
3:50.553 marked_shot Fluffy_Pillow 117.6/150: 78% focus raid_movement
3:51.853 Waiting 0.300 sec 102.6/150: 68% focus raid_movement
3:52.153 barrage Fluffy_Pillow 106.1/150: 71% focus raid_movement
3:55.212 aimed_shot Fluffy_Pillow 81.5/150: 54% focus
3:56.511 Waiting 0.700 sec 96.5/150: 64% focus raid_movement
3:57.211 aimed_shot Fluffy_Pillow 104.6/150: 70% focus
3:58.942 Waiting 0.600 sec 74.7/150: 50% focus
3:59.542 aimed_shot Fluffy_Pillow 81.6/150: 54% focus
4:01.273 sidewinders Fluffy_Pillow 51.7/150: 34% focus marking_targets
4:02.573 marked_shot Fluffy_Pillow 116.7/150: 78% focus
4:03.873 aimed_shot Fluffy_Pillow 101.8/150: 68% focus
4:05.603 aimed_shot Fluffy_Pillow 71.8/150: 48% focus
4:07.335 windburst Fluffy_Pillow 41.9/150: 28% focus
4:08.634 aimed_shot Fluffy_Pillow 36.9/150: 25% focus lock_and_load(2)
4:09.933 aimed_shot Fluffy_Pillow 51.9/150: 35% focus lock_and_load
4:11.232 aimed_shot Fluffy_Pillow 67.0/150: 45% focus
4:12.532 barrage Fluffy_Pillow 82.0/150: 55% focus raid_movement
4:15.346 sidewinders Fluffy_Pillow 54.6/150: 36% focus
4:16.643 aimed_shot Fluffy_Pillow 119.6/150: 80% focus marking_targets
4:18.376 aimed_shot Fluffy_Pillow 89.7/150: 60% focus marking_targets
4:20.004 sidewinders Fluffy_Pillow 108.5/150: 72% focus raid_movement, marking_targets
4:21.306 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
4:22.606 Waiting 1.000 sec 135.1/150: 90% focus raid_movement, marking_targets
4:23.606 aimed_shot Fluffy_Pillow 146.6/150: 98% focus marking_targets
4:25.336 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
4:27.066 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
4:28.365 marked_shot Fluffy_Pillow 135.1/150: 90% focus raid_movement
4:29.665 aimed_shot Fluffy_Pillow 120.2/150: 80% focus
4:31.399 windburst Fluffy_Pillow 90.2/150: 60% focus
4:32.700 barrage Fluffy_Pillow 85.3/150: 57% focus
4:35.569 aimed_shot Fluffy_Pillow 58.5/150: 39% focus
4:37.300 Waiting 0.400 sec 28.6/150: 19% focus
4:37.700 arcane_torrent Fluffy_Pillow 33.2/150: 22% focus
4:37.921 Waiting 0.500 sec 50.7/150: 34% focus
4:38.421 sidewinders Fluffy_Pillow 56.5/150: 38% focus marking_targets
4:39.720 marked_shot Fluffy_Pillow 121.6/150: 81% focus bullseye(5)
4:41.020 aimed_shot Fluffy_Pillow 106.6/150: 71% focus bullseye(10), marking_targets
4:42.752 aimed_shot Fluffy_Pillow 76.7/150: 51% focus bullseye(10), marking_targets
4:44.051 Waiting 1.700 sec 91.7/150: 61% focus raid_movement, bullseye(10), marking_targets
4:45.751 aimed_shot Fluffy_Pillow 111.4/150: 74% focus marking_targets
4:47.483 aimed_shot Fluffy_Pillow 81.4/150: 54% focus marking_targets
4:49.214 sidewinders Fluffy_Pillow 51.5/150: 34% focus marking_targets
4:50.515 marked_shot Fluffy_Pillow 116.6/150: 78% focus raid_movement
4:51.814 Waiting 0.700 sec 101.6/150: 68% focus raid_movement
4:52.514 barrage Fluffy_Pillow 109.7/150: 73% focus raid_movement
4:55.511 windburst Fluffy_Pillow 84.4/150: 56% focus
4:56.811 aimed_shot Fluffy_Pillow 79.4/150: 53% focus marking_targets
4:58.544 aimed_shot Fluffy_Pillow 99.5/150: 66% focus lock_and_load, marking_targets
4:59.842 aimed_shot Fluffy_Pillow 114.5/150: 76% focus marking_targets
5:01.141 sidewinders Fluffy_Pillow 129.6/150: 86% focus raid_movement, marking_targets
5:02.441 marked_shot Fluffy_Pillow 150.0/150: 100% focus
5:03.741 aimed_shot Fluffy_Pillow 135.1/150: 90% focus marking_targets
5:05.473 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
5:07.202 Waiting 0.800 sec 70.1/150: 47% focus marking_targets
5:08.002 sidewinders Fluffy_Pillow 79.3/150: 53% focus marking_targets
5:09.327 marked_shot Fluffy_Pillow 144.7/150: 96% focus bullseye(5), marking_targets
5:10.628 aimed_shot Fluffy_Pillow 129.7/150: 86% focus bullseye(10), marking_targets
5:12.360 aimed_shot Fluffy_Pillow 99.8/150: 67% focus bullseye(10), marking_targets
5:14.090 barrage Fluffy_Pillow 69.8/150: 47% focus bullseye(10), marking_targets
5:16.845 Waiting 0.400 sec 41.7/150: 28% focus raid_movement, marking_targets
5:17.245 windburst Fluffy_Pillow 46.4/150: 31% focus marking_targets
5:18.543 sidewinders Fluffy_Pillow 41.4/150: 28% focus marking_targets
5:19.843 aimed_shot Fluffy_Pillow 106.4/150: 71% focus marking_targets
5:21.576 aimed_shot Fluffy_Pillow 76.5/150: 51% focus marking_targets
5:23.307 Waiting 0.200 sec 96.5/150: 64% focus lock_and_load, marking_targets
5:23.507 marked_shot Fluffy_Pillow 98.9/150: 66% focus lock_and_load, marking_targets
5:24.807 aimed_shot Fluffy_Pillow 83.9/150: 56% focus lock_and_load, marking_targets
5:26.108 aimed_shot Fluffy_Pillow 99.0/150: 66% focus marking_targets
5:27.839 Waiting 0.700 sec 69.0/150: 46% focus marking_targets
5:28.539 sidewinders Fluffy_Pillow 77.1/150: 51% focus marking_targets
5:30.056 aimed_shot Fluffy_Pillow 144.7/150: 96% focus
5:31.788 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
5:33.088 Waiting 0.700 sec 115.1/150: 77% focus raid_movement
5:33.788 marked_shot Fluffy_Pillow 123.2/150: 82% focus
5:35.087 barrage Fluffy_Pillow 108.3/150: 72% focus bullseye
5:37.873 aimed_shot Fluffy_Pillow 80.5/150: 54% focus bullseye(17)
5:39.603 windburst Fluffy_Pillow 50.5/150: 34% focus bullseye(18), marking_targets
5:40.903 trueshot Fluffy_Pillow 45.6/150: 30% focus bullseye(20), marking_targets
5:41.018 sidewinders Fluffy_Pillow 46.9/150: 31% focus bullseye(20), marking_targets, rapid_killing, trueshot
5:41.948 aimed_shot Fluffy_Pillow 112.0/150: 75% focus bullseye(22), rapid_killing, trueshot
5:43.183 aimed_shot Fluffy_Pillow 82.0/150: 55% focus bullseye(22), rapid_killing, trueshot
5:44.419 aimed_shot Fluffy_Pillow 52.0/150: 35% focus bullseye(24), marking_targets, rapid_killing, trueshot
5:45.658 aimed_shot Fluffy_Pillow 72.1/150: 48% focus bullseye(26), lock_and_load, marking_targets, rapid_killing, trueshot
5:46.588 marked_shot Fluffy_Pillow 87.2/150: 58% focus bullseye(28), marking_targets, rapid_killing, trueshot
5:47.518 aimed_shot Fluffy_Pillow 72.3/150: 48% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:48.448 Waiting 0.700 sec 87.4/150: 58% focus raid_movement, bullseye(30), marking_targets, rapid_killing, trueshot
5:49.148 aimed_shot Fluffy_Pillow 98.7/150: 66% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:50.384 aimed_shot Fluffy_Pillow 68.7/150: 46% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:51.623 sidewinders Fluffy_Pillow 38.8/150: 26% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:52.552 marked_shot Fluffy_Pillow 103.9/150: 69% focus bullseye(30), rapid_killing, trueshot
5:53.480 aimed_shot Fluffy_Pillow 88.9/150: 59% focus bullseye(30), rapid_killing, trueshot
5:54.719 aimed_shot Fluffy_Pillow 59.0/150: 39% focus bullseye(30), rapid_killing, trueshot
5:55.955 Waiting 2.500 sec 29.0/150: 19% focus bullseye(30), rapid_killing, trueshot
5:58.455 aimed_shot Fluffy_Pillow 58.3/150: 39% focus bullseye(30)
6:00.187 barrage Fluffy_Pillow 78.3/150: 52% focus bullseye(30), lock_and_load
6:03.066 windburst Fluffy_Pillow 51.7/150: 34% focus bullseye(30), lock_and_load
6:04.364 sidewinders Fluffy_Pillow 66.7/150: 44% focus raid_movement, bullseye(30), lock_and_load, marking_targets
6:05.662 aimed_shot Fluffy_Pillow 131.7/150: 88% focus bullseye(30), lock_and_load
6:06.962 aimed_shot Fluffy_Pillow 146.8/150: 98% focus bullseye(30)
6:08.693 arcane_torrent Fluffy_Pillow 100.0/150: 67% focus bullseye(30)
6:08.693 Waiting 0.400 sec 115.0/150: 77% focus bullseye(30)
6:09.093 aimed_shot Fluffy_Pillow 119.7/150: 80% focus bullseye(30)
6:10.825 marked_shot Fluffy_Pillow 89.7/150: 60% focus bullseye(30)
6:12.124 aimed_shot Fluffy_Pillow 74.8/150: 50% focus bullseye(30)
6:13.857 sidewinders Fluffy_Pillow 44.8/150: 30% focus bullseye(30)
6:15.155 aimed_shot Fluffy_Pillow 109.9/150: 73% focus bullseye(30)
6:16.887 aimed_shot Fluffy_Pillow 79.9/150: 53% focus bullseye(30), marking_targets
6:18.620 sidewinders Fluffy_Pillow 50.0/150: 33% focus bullseye(30), marking_targets
6:19.920 aimed_shot Fluffy_Pillow 115.0/150: 77% focus bullseye(30)
6:21.220 barrage Fluffy_Pillow 130.1/150: 87% focus bullseye(30)
6:24.040 windburst Fluffy_Pillow 102.7/150: 68% focus bullseye(30)
6:25.339 aimed_shot Fluffy_Pillow 97.8/150: 65% focus bullseye(30)
6:27.070 aimed_shot Fluffy_Pillow 67.8/150: 45% focus bullseye(30)
6:28.801 Waiting 0.900 sec 37.9/150: 25% focus bullseye(30)
6:29.701 marked_shot Fluffy_Pillow 48.3/150: 32% focus bullseye(30)
6:31.002 Waiting 1.500 sec 33.3/150: 22% focus bullseye(30)
6:32.502 aimed_shot Fluffy_Pillow 50.7/150: 34% focus bullseye(30)
6:34.233 Waiting 0.200 sec 20.7/150: 14% focus bullseye(30)
6:34.433 sidewinders Fluffy_Pillow 23.1/150: 15% focus bullseye(30)
6:35.733 aimed_shot Fluffy_Pillow 88.1/150: 59% focus bullseye(30), marking_targets
6:37.032 Waiting 0.200 sec 103.2/150: 69% focus raid_movement, bullseye(30), marking_targets
6:37.232 aimed_shot Fluffy_Pillow 105.5/150: 70% focus bullseye(30), marking_targets
6:38.963 sidewinders Fluffy_Pillow 75.5/150: 50% focus bullseye(30), marking_targets
6:40.262 aimed_shot Fluffy_Pillow 140.5/150: 94% focus bullseye(30)
6:41.992 barrage Fluffy_Pillow 100.0/150: 67% focus bullseye(30)
6:44.771 marked_shot Fluffy_Pillow 72.2/150: 48% focus bullseye(30)
6:46.071 windburst Fluffy_Pillow 57.3/150: 38% focus bullseye(30)
6:47.370 aimed_shot Fluffy_Pillow 52.3/150: 35% focus bullseye(30)
6:49.101 sidewinders Fluffy_Pillow 22.3/150: 15% focus bullseye(30)
6:50.401 aimed_shot Fluffy_Pillow 87.4/150: 58% focus bullseye(30)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6228 6228 0
Agility 26059 24694 14487 (11042)
Stamina 31510 31510 19945
Intellect 6009 6009 0
Spirit 2 2 0
Health 1890600 1890600 0
Focus 150 150 0
Crit 28.34% 28.34% 4319
Haste 15.78% 15.78% 5128
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 26059 24694 0
Mastery 19.96% 19.96% 8374
Armor 2520 2520 2520
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 856.00
Local Head Greyed Dragonscale Coif
ilevel: 855, stats: { 341 Armor, +2038 Sta, +1359 AgiInt, +751 Mastery, +579 Crit }
Local Neck Nightborne's Jeweled Necklace
ilevel: 830, stats: { +908 Sta, +1217 Mastery, +487 Haste }
Local Shoulders Arcane Exterminator's Shoulderguards
ilevel: 830, stats: { 292 Armor, +807 AgiInt, +1211 Sta, +649 Crit, +259 Haste }
Local Chest Ley Dragoon's Hauberk
ilevel: 840, stats: { 401 Armor, +1182 AgiInt, +1773 Sta, +844 Mastery, +413 Haste }
Local Waist Belt of Mighty Links
ilevel: 865, stats: { 244 Armor, +1119 AgiInt, +1678 Sta, +673 Mastery, +362 Haste }
Local Legs Tempered Seaborne Leggings
ilevel: 850, stats: { 362 Armor, +1945 Sta, +1297 AgiInt, +820 Haste, +484 Crit }
Local Feet Frostburned Sabatons
ilevel: 860, stats: { 293 Armor, +1601 Sta, +1068 AgiInt, +617 Crit, +399 Haste }
Local Wrists Assorted Dragonscale Bracers
ilevel: 870, stats: { 193 Armor, +1319 Sta, +879 AgiInt, +548 Haste, +242 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 850, stats: { 259 Armor, +1459 Sta, +973 AgiInt, +574 Crit, +406 Mastery }, gems: { +150 Mastery }
Local Finger1 Signet of the Highborne Magi
ilevel: 840, stats: { +997 Sta, +1111 Mastery, +657 Crit }, gems: { +150 Mastery }, enchant: { +150 Mastery }
Local Finger2 Arch-Druid's Tainted Seal
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: { +150 Mastery }
Local Trinket1 Deteriorated Construct Core
ilevel: 875, stats: { +1557 AgiInt }
Local Trinket2 Three-Toed Rabbit Foot
ilevel: 880, stats: { +1631 Agi, +1043 Haste }
Local Back Drape of the Raven Lord
ilevel: 860, stats: { 135 Armor, +801 StrAgiInt, +1201 Sta, +490 Mastery, +272 Haste }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 886, weapon: { 9775 - 9777, 3 }, stats: { +1814 Agi, +2721 Sta, +759 Crit, +729 Mastery }, relics: { +45 ilevels, +43 ilevels, +48 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Rothlandra"
origin="https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/85/161015381-avatar.jpg"
level=110
race=blood_elf
role=attack
position=ranged_back
professions=mining=238/herbalism=260
talents=1113121
artifact=55:0:0:0:0:307:1:308:1:310:1:312:3:313:3:315:3:318:1:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1477/3336
neck=nightbornes_jeweled_necklace,id=134275,bonus_id=3397/1492/1675
shoulders=arcane_exterminators_shoulderguards,id=134472,bonus_id=1482
back=drape_of_the_raven_lord,id=136770,bonus_id=1727/1512/3337
chest=ley_dragoons_hauberk,id=134302,bonus_id=3397/1502/3336
wrists=assorted_dragonscale_bracers,id=141433,bonus_id=3466/1482/3336
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1807/1808/1472,gems=150mastery
waist=belt_of_mighty_links,id=137456,bonus_id=3413/1517/3337
legs=tempered_seaborne_leggings,id=133769,bonus_id=3410/1502/3336
feet=frostburned_sabatons,id=141432,bonus_id=1472
finger1=signet_of_the_highborne_magi,id=134537,bonus_id=1727/1808/1492/1813,gems=150mastery,enchant=150mastery
finger2=archdruids_tainted_seal,id=134487,bonus_id=3410/1502/3336,enchant=150mastery
trinket1=deteriorated_construct_core,id=142165,bonus_id=3453/1487/3337
trinket2=threetoed_rabbit_foot,id=134203,bonus_id=3474/604/1542/3337
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=142194/139260/141256/0,relic_id=3452:1472/1807:1472/3474:1527:3337/0

# Gear Summary
# gear_ilvl=856.07
# gear_agility=14487
# gear_stamina=19945
# gear_crit_rating=4319
# gear_haste_rating=5128
# gear_mastery_rating=8374
# gear_armor=2520
summon_pet=cat

Sarkul

Sarkul : 455079 dps, 285242 dps to main target

  • Race: Orc
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
455079.3 455079.3 618.4 / 0.136% 119067.4 / 26.2% 27581.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.4 16.4 Focus 18.27% 35.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Sarkul/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Trailblazer
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Volley
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • engineering: 707
Scale Factors for Sarkul Damage Per Second
Agi Haste Mastery Vers Crit
Scale Factors 13.13 12.22 11.76 11.03 10.82
Normalized 1.00 0.93 0.90 0.84 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.78 0.79 0.78 0.78 0.78
Gear Ranking
Optimizers
Ranking
  • Agi > Haste ~= Mastery ~= Vers ~= Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=13.13, CritRating=10.82, HasteRating=12.22, MasteryRating=11.76, Versatility=11.03 )

Scale Factors for other metrics

Scale Factors for Sarkul Damage Per Second
Agi Haste Mastery Vers Crit
Scale Factors 13.13 12.22 11.76 11.03 10.82
Normalized 1.00 0.93 0.90 0.84 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.78 0.79 0.78 0.78 0.78
Gear Ranking
Optimizers
Ranking
  • Agi > Haste ~= Mastery ~= Vers ~= Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=13.13, CritRating=10.82, HasteRating=12.22, MasteryRating=11.76, Versatility=11.03 )
Scale Factors for Sarkul Priority Target Damage Per Second
Mastery Agi Haste Crit Vers
Scale Factors 7.60 7.54 7.49 7.06 6.99
Normalized 1.01 1.00 0.99 0.94 0.93
Scale Deltas 1138 1138 1138 1138 1138
Error 0.27 0.27 0.27 0.27 0.27
Gear Ranking
Optimizers
Ranking
  • Mastery ~= Agi ~= Haste > Crit ~= Vers
Pawn string ( Pawn: v1: "Sarkul": Agility=7.54, CritRating=7.06, HasteRating=7.49, MasteryRating=7.60, Versatility=6.99 )
Scale Factors for Sarkul Damage Per Second (Effective)
Agi Haste Mastery Vers Crit
Scale Factors 13.13 12.22 11.76 11.03 10.82
Normalized 1.00 0.93 0.90 0.84 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Mastery > Vers > Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=13.13, CritRating=10.82, HasteRating=12.22, MasteryRating=11.76, Versatility=11.03 )
Scale Factors for Sarkul Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for SarkulTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sarkul 455079
Aimed Shot 114209 (134191) 25.3% (29.7%) 118.1 3.39sec 455293 279522 Direct 118.0 268286 623578 387927 33.7%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.13 118.00 0.00 0.00 1.6288 0.0000 45773322.84 67291120.35 31.98 279521.81 279521.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.26 66.33% 268285.68 109777 291218 268259.15 247818 279561 20997174 30867834 31.98
crit 39.73 33.67% 623578.26 230532 931897 623445.68 537600 697087 24776149 36423286 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 19982 4.4% 0.0 0.00sec 0 0 Direct 106.2 52062 121284 75430 33.8%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 106.19 0.00 0.00 0.0000 0.0000 8010028.29 11775500.32 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.34 66.24% 52062.06 21525 57102 52055.33 39057 55971 3662181 5383753 31.98
crit 35.85 33.76% 121284.21 45202 182725 121147.79 72324 160968 4347847 6391748 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 13687 (87766) 3.0% (19.2%) 162.9 2.47sec 213851 87173 Direct 162.9 25468 55133 33653 27.6%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.91 162.91 0.00 0.00 2.4532 0.0000 5482312.47 8059518.63 31.98 87173.21 87173.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 117.96 72.41% 25468.18 25206 26779 25469.34 25345 25595 3004300 4416606 31.98
crit 44.95 27.59% 55132.80 50411 80336 55143.39 50411 60402 2478012 3642913 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Volley 74078 16.2% 163.9 2.47sec 179099 0 Direct 553.8 41882 87605 53009 24.3%  

Stats details: volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 163.91 553.79 0.00 0.00 0.0000 0.0000 29356025.61 43156138.33 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 419.02 75.66% 41882.04 41491 45162 41882.16 41747 42010 17549561 25799517 31.98
crit 134.77 24.34% 87604.53 82981 135485 87592.99 84031 93846 11806465 17356621 31.98
 
 

Action details: volley

Static Values
  • id:194386
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:194386
  • name:Volley
  • school:physical
  • tooltip:Auto attacks also spend {$s1=3} Focus to launch a volley of shots that hit the target and all other nearby enemies.
  • description:While active, your auto attacks spend {$s1=3} Focus to also launch a volley of shots that hit the target and all other nearby enemies, dealing {$194392s1=0} additional Physical damage.
 
Deadly Grace 9577 2.1% 31.8 10.56sec 118775 0 Direct 31.8 80707 204804 118878 30.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.85 31.82 0.00 0.00 0.0000 0.0000 3782613.88 3782613.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.03 69.24% 80706.98 80707 80707 80706.98 80707 80707 1778209 1778209 0.00
crit 9.79 30.76% 204804.28 161414 242121 203168.69 0 242121 2004405 2004405 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of the Hidden Satyr 3846 0.9% 23.0 17.35sec 67026 0 Direct 23.0 50459 109442 67028 28.1%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.98 22.98 0.00 0.00 0.0000 0.0000 1540583.46 1540583.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.53 71.91% 50459.06 50459 50459 50459.06 50459 50459 834041 834041 0.00
crit 6.46 28.09% 109442.29 100918 151377 109382.40 0 151377 706543 706543 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Marked Shot 113839 (123969) 24.9% (27.1%) 36.7 10.98sec 1338603 1095561 Direct 100.7 323356 681836 448792 35.0%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.74 100.66 0.00 0.00 1.2219 0.0000 45174586.66 66410921.45 31.98 1095560.55 1095560.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.44 65.01% 323356.11 132128 350512 323406.96 271841 338397 21159235 31106080 31.98
crit 35.22 34.99% 681835.90 264257 1051535 682266.78 567291 811858 24015352 35304842 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Call of the Hunter 10129 2.2% 14.8 51.37sec 269812 0 Direct 49.2 62996 133978 81339 25.8%  

Stats details: call_of_the_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.84 49.23 0.00 0.00 0.0000 0.0000 4004030.96 5886304.78 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.51 74.16% 62995.93 62229 67735 63032.02 0 67735 2299724 3380813 31.97
crit 12.72 25.84% 133978.11 124458 203204 134269.11 0 203204 1704307 2505492 31.96
 
 

Action details: call_of_the_hunter

Static Values
  • id:191070
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191070
  • name:Call of the Hunter
  • school:physical
  • tooltip:
  • description:{$@spelldesc191048=When you Marked Shot, |cFFFFCC99Thas'dorah|r has a chance to call forth a barrage of wind arrows to strike all Vulnerable targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 3833 0.8% 18.3 21.72sec 83793 0 Periodic 90.5 16975 0 16975 0.0% 5.7%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.33 0.00 91.25 90.46 0.0000 0.2498 1535591.26 1535591.26 0.00 67377.09 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.5 100.00% 16974.60 68 16990 16975.26 16611 16990 1535591 1535591 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Rancid Maw 11683 2.6% 18.4 21.53sec 254621 0 Direct 18.3 193161 419710 256205 27.8%  

Stats details: rancid_maw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.38 18.27 0.00 0.00 0.0000 0.0000 4679995.32 4679995.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.18 72.17% 193161.37 193161 193161 193161.37 193161 193161 2546566 2546566 0.00
crit 5.08 27.83% 419709.73 386323 579484 417711.23 0 579484 2133430 2133430 0.00
 
 

Action details: rancid_maw

Static Values
  • id:215405
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215405
  • name:Rancid Maw
  • school:nature
  • tooltip:
  • description:{$@spelldesc215404=Your ranged attacks and spells have a chance to launch a ball of venom that deals up to {$215405s1=112984 to 124877} Nature damage, based on your distance from the target (maximum damage at 20 yards).}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:180015.50
  • base_dd_max:198964.50
 
Sidewinders 46959 10.3% 41.9 9.64sec 444424 361848 Direct 140.4 104545 218760 132583 24.5%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.88 140.39 0.00 0.00 1.2282 0.0000 18613484.66 18613484.66 0.00 361848.46 361848.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.93 75.45% 104544.70 103374 112520 104547.82 103545 105683 11074103 11074103 0.00
crit 34.46 24.55% 218759.82 206748 337560 218753.13 206748 250086 7539382 7539382 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Tormenting Cyclone 12258 2.7% 13.7 28.47sec 354041 0 Direct 323.5 11830 24751 15003 24.6%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.71 323.53 0.00 0.00 0.0000 0.0000 4854102.42 4854102.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 244.07 75.44% 11829.85 11830 11830 11829.85 11830 11830 2887255 2887255 0.00
crit 79.46 24.56% 24751.45 23660 35490 24755.24 23660 31096 1966847 1966847 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Windburst 20998 4.6% 15.8 24.63sec 531957 386744 Direct 16.8 386417 807316 501137 27.3%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.81 16.78 0.00 0.00 1.3755 0.0000 8408586.94 12361419.28 31.98 386743.95 386743.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.21 72.74% 386416.72 384374 407868 386394.44 384374 391422 4716341 6933468 31.98
crit 4.57 27.26% 807316.43 768747 1223604 803744.01 0 1153121 3692246 5427951 31.80
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Sarkul
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
Blood Fury 3.8 120.49sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.7 203.74sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.69 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:160.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Fury 3.8 0.0 120.5sec 120.5sec 13.89% 13.89% 0.0(0.0) 3.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:13.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 21.79% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 10.3 239.1 30.9sec 1.5sec 37.72% 37.72% 105.6(105.6) 9.3

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.08%
  • bullseye_2:0.13%
  • bullseye_3:0.18%
  • bullseye_4:0.15%
  • bullseye_5:5.50%
  • bullseye_6:0.15%
  • bullseye_7:0.16%
  • bullseye_8:0.13%
  • bullseye_9:0.14%
  • bullseye_10:6.84%
  • bullseye_11:0.13%
  • bullseye_12:0.14%
  • bullseye_13:0.16%
  • bullseye_14:0.14%
  • bullseye_15:5.13%
  • bullseye_16:0.15%
  • bullseye_17:0.15%
  • bullseye_18:0.14%
  • bullseye_19:0.14%
  • bullseye_20:1.02%
  • bullseye_21:0.14%
  • bullseye_22:0.15%
  • bullseye_23:0.14%
  • bullseye_24:0.14%
  • bullseye_25:0.70%
  • bullseye_26:0.14%
  • bullseye_27:0.14%
  • bullseye_28:0.13%
  • bullseye_29:0.11%
  • bullseye_30:15.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 12.5 0.5 30.4sec 29.2sec 7.46% 10.56% 0.5(0.6) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:3.87%
  • lock_and_load_2:3.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 35.1 10.4 11.5sec 8.8sec 34.51% 49.93% 10.4(10.4) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:34.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 288.4sec 0.0sec 14.68% 14.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 2.7 0.0 201.4sec 203.6sec 10.03% 13.60% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:10.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.7 0.0 201.4sec 203.6sec 10.03% 16.78% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:10.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Volley

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_volley
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • volley_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194386
  • name:Volley
  • tooltip:Auto attacks also spend {$s1=3} Focus to launch a volley of shots that hit the target and all other nearby enemies.
  • description:While active, your auto attacks spend {$s1=3} Focus to also launch a volley of shots that hit the target and all other nearby enemies, dealing {$194392s1=0} additional Physical damage.
  • max_stacks:0
  • duration:-0.00
  • cooldown:1.50
  • default_chance:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Sarkul
aimed_shot Focus 118.1 4643.5 39.3 39.3 11582.6
marked_shot Focus 36.7 1102.2 30.0 30.0 44620.1
volley Focus 162.9 488.7 3.0 3.0 60066.2
windburst Focus 16.8 336.1 20.0 21.3 25015.0
Resource Gains Type Count Total Average Overflow
sidewinders Focus 41.88 1991.73 (30.62%) 47.56 102.38 4.89%
focus_regen Focus 1449.43 4512.50 (69.38%) 3.11 349.82 7.19%
Resource RPS-Gain RPS-Loss
Focus 16.22 16.39
Combat End Resource Mean Min Max
Focus 84.64 12.70 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 4.7%

Procs

Count Interval
lock_and_load 13.0 29.2sec
no_vuln_aimed_shot 4.6 49.4sec
no_vuln_marked_shot 6.5 45.4sec
marking_targets 45.6 8.8sec
wasted_marking_targets 10.4 34.9sec

Statistics & Data Analysis

Fight Length
Sample Data Sarkul Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Sarkul Damage Per Second
Count 9999
Mean 455079.26
Minimum 371460.82
Maximum 589903.48
Spread ( max - min ) 218442.67
Range [ ( max - min ) / 2 * 100% ] 24.00%
Standard Deviation 31549.2084
5th Percentile 408367.43
95th Percentile 510701.75
( 95th Percentile - 5th Percentile ) 102334.31
Mean Distribution
Standard Deviation 315.5079
95.00% Confidence Intervall ( 454460.88 - 455697.65 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 184
0.1% Error 18462
0.1 Scale Factor Error with Delta=300 8496901
0.05 Scale Factor Error with Delta=300 33987607
0.01 Scale Factor Error with Delta=300 849690188
Priority Target DPS
Sample Data Sarkul Priority Target Damage Per Second
Count 9999
Mean 285242.40
Minimum 247190.36
Maximum 328692.49
Spread ( max - min ) 81502.13
Range [ ( max - min ) / 2 * 100% ] 14.29%
Standard Deviation 11105.2382
5th Percentile 267457.25
95th Percentile 304156.38
( 95th Percentile - 5th Percentile ) 36699.13
Mean Distribution
Standard Deviation 111.0579
95.00% Confidence Intervall ( 285024.73 - 285460.07 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 58
0.1% Error 5822
0.1 Scale Factor Error with Delta=300 1052784
0.05 Scale Factor Error with Delta=300 4211137
0.01 Scale Factor Error with Delta=300 105278437
DPS(e)
Sample Data Sarkul Damage Per Second (Effective)
Count 9999
Mean 455079.26
Minimum 371460.82
Maximum 589903.48
Spread ( max - min ) 218442.67
Range [ ( max - min ) / 2 * 100% ] 24.00%
Damage
Sample Data Sarkul Damage
Count 9999
Mean 181215264.77
Minimum 135512184.74
Maximum 219067040.24
Spread ( max - min ) 83554855.51
Range [ ( max - min ) / 2 * 100% ] 23.05%
DTPS
Sample Data Sarkul Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sarkul Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sarkul Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sarkul Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sarkul Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sarkul Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SarkulTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sarkul Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 volley
7 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
9 3.77 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
A 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
B 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
C 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
0.00 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
0.00 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
D 17.79 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
E 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
F 10.37 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
0.00 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
G 59.30 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
H 57.35 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
I 31.11 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
J 1.27 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
K 27.00 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
L 6.31 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
M 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
N 1.69 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
O 1.00 trueshot
P 1.46 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
Q 3.54 marked_shot
R 1.12 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
0.00 barrage
S 8.78 aimed_shot,if=execute_time<debuff.vulnerability.remains
T 2.20 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
U 0.82 marked_shot
0.00 windburst
V 1.65 aimed_shot,if=execute_time<debuff.vulnerability.remains
W 0.86 sidewinders
X 0.08 aimed_shot
0.00 arcane_shot

Sample Sequence

0456789OSSPQSSSTQSTQSSSTQHHDHFHHHLKGGIHDFHHKGIHKGGIHDHKGGIKGGIHDHHHKIHHKGGIDLFHH9KGGIHDKGGIKGIHHDHHHHKGGNGIFGGGIHFIDHHHKGGIKGIHHDKGGIHLLKGGDIKGGIHKGIHDHH9KGGIKMGGIHDKIHLLLKGGIHDHHKGGIKGGGIHHDHHFHHKGGIHDHKGGIHHKGGDJKNGGIFGGIHH9HKGDGGIKGGIHKGGDJKGGIHVWVV

Sample Sequence Table

time name target resources buffs
Pre flask Sarkul 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Sarkul 150.0/150: 100% focus potion_of_deadly_grace
Pre volley Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 blood_fury Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus blood_fury, potion_of_deadly_grace
0:00.000 aimed_shot Fluffy_Pillow 130.0/150: 87% focus blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:01.268 aimed_shot Fluffy_Pillow 99.6/150: 66% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:02.243 sidewinders Fluffy_Pillow 69.6/150: 46% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:02.997 marked_shot Fluffy_Pillow 132.1/150: 88% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:03.751 aimed_shot Fluffy_Pillow 117.6/150: 78% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:04.729 aimed_shot Fluffy_Pillow 84.8/150: 57% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:05.705 aimed_shot Fluffy_Pillow 51.8/150: 35% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:06.682 sidewinders Fluffy_Pillow 21.9/150: 15% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:07.436 marked_shot Fluffy_Pillow 84.4/150: 56% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:08.191 aimed_shot Fluffy_Pillow 69.9/150: 47% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:09.168 sidewinders Fluffy_Pillow 37.0/150: 25% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:09.922 marked_shot Fluffy_Pillow 99.5/150: 66% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:10.677 aimed_shot Fluffy_Pillow 85.0/150: 57% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:11.654 aimed_shot Fluffy_Pillow 52.1/150: 35% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:12.408 Waiting 0.800 sec 67.6/150: 45% focus bloodlust, blood_fury, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:13.208 aimed_shot Fluffy_Pillow 81.1/150: 54% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.185 sidewinders Fluffy_Pillow 48.2/150: 32% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.941 marked_shot Fluffy_Pillow 113.7/150: 76% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:15.694 aimed_shot Fluffy_Pillow 92.1/150: 61% focus bloodlust, potion_of_deadly_grace
0:17.060 aimed_shot Fluffy_Pillow 62.2/150: 41% focus bloodlust, potion_of_deadly_grace
0:18.425 Waiting 1.400 sec 29.2/150: 19% focus bloodlust, potion_of_deadly_grace
0:19.825 windburst Fluffy_Pillow 46.8/150: 31% focus bloodlust, potion_of_deadly_grace
0:21.026 Waiting 2.600 sec 44.4/150: 30% focus bloodlust, raid_movement, potion_of_deadly_grace
0:23.626 aimed_shot Fluffy_Pillow 79.6/150: 53% focus bloodlust, potion_of_deadly_grace
0:24.992 Waiting 0.100 sec 46.7/150: 31% focus bloodlust, potion_of_deadly_grace
0:25.092 sidewinders Fluffy_Pillow 48.1/150: 32% focus bloodlust, potion_of_deadly_grace
0:26.118 aimed_shot Fluffy_Pillow 110.2/150: 73% focus bloodlust, potion_of_deadly_grace
0:27.484 aimed_shot Fluffy_Pillow 80.3/150: 54% focus bloodlust, potion_of_deadly_grace
0:28.511 Waiting 0.700 sec 92.4/150: 62% focus bloodlust, raid_movement
0:29.211 aimed_shot Fluffy_Pillow 102.6/150: 68% focus bloodlust
0:30.576 Waiting 0.800 sec 69.7/150: 46% focus bloodlust
0:31.376 aimed_shot Fluffy_Pillow 81.4/150: 54% focus bloodlust
0:32.741 sidewinders Fluffy_Pillow 48.5/150: 32% focus bloodlust, marking_targets
0:33.766 aimed_shot Fluffy_Pillow 113.5/150: 76% focus bloodlust
0:35.131 aimed_shot Fluffy_Pillow 80.6/150: 54% focus bloodlust
0:36.498 marked_shot Fluffy_Pillow 47.7/150: 32% focus bloodlust, bullseye(5)
0:37.525 Waiting 1.400 sec 32.7/150: 22% focus bloodlust, bullseye(10)
0:38.925 aimed_shot Fluffy_Pillow 50.3/150: 34% focus bloodlust, bullseye(15)
0:40.290 Waiting 0.500 sec 17.3/150: 12% focus bloodlust, bullseye(15)
0:40.790 windburst Fluffy_Pillow 24.7/150: 16% focus bloodlust, bullseye(15)
0:42.354 sidewinders Fluffy_Pillow 22.4/150: 15% focus bullseye(15)
0:43.687 aimed_shot Fluffy_Pillow 84.4/150: 56% focus bullseye(15)
0:45.019 Waiting 0.200 sec 99.5/150: 66% focus raid_movement
0:45.219 aimed_shot Fluffy_Pillow 101.7/150: 68% focus
0:46.993 Waiting 1.400 sec 68.8/150: 46% focus
0:48.393 sidewinders Fluffy_Pillow 81.6/150: 54% focus marking_targets
0:49.724 aimed_shot Fluffy_Pillow 146.6/150: 98% focus
0:51.056 marked_shot Fluffy_Pillow 147.3/150: 98% focus raid_movement
0:52.387 Waiting 1.200 sec 132.3/150: 88% focus raid_movement
0:53.587 aimed_shot Fluffy_Pillow 145.9/150: 97% focus
0:55.361 sidewinders Fluffy_Pillow 100.0/150: 67% focus marking_targets
0:56.692 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
0:58.467 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
1:00.004 marked_shot Fluffy_Pillow 114.4/150: 76% focus raid_movement, marking_targets
1:01.337 aimed_shot Fluffy_Pillow 99.5/150: 66% focus marking_targets
1:03.111 windburst Fluffy_Pillow 66.5/150: 44% focus marking_targets
1:04.443 aimed_shot Fluffy_Pillow 58.6/150: 39% focus marking_targets
1:06.216 sidewinders Fluffy_Pillow 28.6/150: 19% focus marking_targets
1:07.548 aimed_shot Fluffy_Pillow 90.6/150: 60% focus bullseye(10), marking_targets
1:09.323 aimed_shot Fluffy_Pillow 60.7/150: 40% focus bullseye(10), marking_targets
1:11.098 Waiting 0.200 sec 27.7/150: 18% focus bullseye(15), marking_targets
1:11.298 marked_shot Fluffy_Pillow 30.0/150: 20% focus bullseye(15), marking_targets
1:12.630 Waiting 1.400 sec 12.1/150: 8% focus bullseye(15), marking_targets
1:14.030 sidewinders Fluffy_Pillow 27.9/150: 19% focus bullseye(15), marking_targets
1:15.553 aimed_shot Fluffy_Pillow 92.1/150: 61% focus bullseye(15)
1:16.885 Waiting 0.300 sec 107.1/150: 71% focus raid_movement
1:17.185 aimed_shot Fluffy_Pillow 110.5/150: 74% focus
1:18.959 Waiting 0.300 sec 127.6/150: 85% focus lock_and_load
1:19.259 marked_shot Fluffy_Pillow 130.9/150: 87% focus lock_and_load
1:20.593 Waiting 3.000 sec 113.0/150: 75% focus raid_movement, lock_and_load
1:23.593 aimed_shot Fluffy_Pillow 143.9/150: 96% focus lock_and_load
1:24.924 windburst Fluffy_Pillow 150.0/150: 100% focus
1:26.256 aimed_shot Fluffy_Pillow 130.1/150: 87% focus
1:28.029 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
1:29.803 aimed_shot Fluffy_Pillow 67.1/150: 45% focus marking_targets
1:31.578 sidewinders Fluffy_Pillow 34.1/150: 23% focus marking_targets
1:32.907 marked_shot Fluffy_Pillow 99.1/150: 66% focus raid_movement
1:34.238 aimed_shot Fluffy_Pillow 81.2/150: 54% focus
1:36.014 aimed_shot Fluffy_Pillow 51.2/150: 34% focus
1:37.789 sidewinders Fluffy_Pillow 18.3/150: 12% focus bullseye(5), marking_targets
1:39.120 aimed_shot Fluffy_Pillow 80.3/150: 54% focus bullseye(15)
1:40.896 aimed_shot Fluffy_Pillow 50.4/150: 34% focus bullseye(15)
1:42.670 Waiting 1.200 sec 17.4/150: 12% focus bullseye(15)
1:43.870 marked_shot Fluffy_Pillow 31.0/150: 21% focus bullseye(15)
1:45.201 Waiting 0.800 sec 13.0/150: 9% focus
1:46.001 windburst Fluffy_Pillow 22.1/150: 15% focus
1:47.581 Waiting 6.200 sec 16.9/150: 11% focus
1:53.781 aimed_shot Fluffy_Pillow 81.0/150: 54% focus
1:55.555 Waiting 0.100 sec 48.0/150: 32% focus
1:55.655 sidewinders Fluffy_Pillow 49.1/150: 33% focus
1:56.988 aimed_shot Fluffy_Pillow 114.2/150: 76% focus
1:58.760 aimed_shot Fluffy_Pillow 81.2/150: 54% focus marking_targets
2:00.534 blood_fury Fluffy_Pillow 48.2/150: 32% focus marking_targets
2:00.534 sidewinders Fluffy_Pillow 48.2/150: 32% focus blood_fury, marking_targets
2:01.866 aimed_shot Fluffy_Pillow 113.3/150: 76% focus blood_fury
2:03.641 aimed_shot Fluffy_Pillow 80.3/150: 54% focus blood_fury
2:04.972 marked_shot Fluffy_Pillow 95.4/150: 64% focus blood_fury, raid_movement
2:06.303 aimed_shot Fluffy_Pillow 77.4/150: 52% focus blood_fury, marking_targets
2:08.076 windburst Fluffy_Pillow 44.4/150: 30% focus blood_fury, bullseye(5), marking_targets
2:09.409 sidewinders Fluffy_Pillow 39.5/150: 26% focus blood_fury, bullseye(5), marking_targets
2:10.740 aimed_shot Fluffy_Pillow 101.5/150: 68% focus blood_fury, bullseye(10)
2:12.513 aimed_shot Fluffy_Pillow 71.6/150: 48% focus blood_fury, bullseye(10)
2:14.288 Waiting 0.200 sec 38.6/150: 26% focus blood_fury, bullseye(10), marking_targets
2:14.488 marked_shot Fluffy_Pillow 40.9/150: 27% focus blood_fury, bullseye(10), marking_targets
2:15.821 Waiting 1.900 sec 25.9/150: 17% focus marking_targets
2:17.721 sidewinders Fluffy_Pillow 44.4/150: 30% focus marking_targets
2:19.284 aimed_shot Fluffy_Pillow 109.1/150: 73% focus
2:20.616 marked_shot Fluffy_Pillow 124.1/150: 83% focus raid_movement
2:21.948 aimed_shot Fluffy_Pillow 106.2/150: 71% focus marking_targets
2:23.721 aimed_shot Fluffy_Pillow 76.2/150: 51% focus marking_targets
2:25.497 Waiting 3.700 sec 93.2/150: 62% focus lock_and_load, marking_targets
2:29.197 windburst Fluffy_Pillow 132.0/150: 88% focus lock_and_load, marking_targets
2:30.732 aimed_shot Fluffy_Pillow 126.4/150: 84% focus lock_and_load, marking_targets
2:32.063 aimed_shot Fluffy_Pillow 138.4/150: 92% focus lock_and_load(2), marking_targets
2:33.393 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
2:34.725 aimed_shot Fluffy_Pillow 148.7/150: 99% focus lock_and_load(2), marking_targets
2:36.057 sidewinders Fluffy_Pillow 150.0/150: 100% focus raid_movement, lock_and_load, marking_targets
2:37.390 aimed_shot Fluffy_Pillow 148.8/150: 99% focus bullseye(10), lock_and_load, marking_targets
2:38.721 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(10), marking_targets
2:40.495 trueshot Fluffy_Pillow 100.0/150: 67% focus bullseye(15), marking_targets
2:40.495 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bullseye(15), marking_targets, rapid_killing, trueshot
2:41.763 marked_shot Fluffy_Pillow 70.1/150: 47% focus bullseye(15), marking_targets, rapid_killing, trueshot
2:42.716 sidewinders Fluffy_Pillow 52.2/150: 35% focus bullseye(15), marking_targets, rapid_killing, trueshot
2:43.669 aimed_shot Fluffy_Pillow 117.2/150: 78% focus bullseye(15), rapid_killing, trueshot
2:44.938 aimed_shot Fluffy_Pillow 84.3/150: 56% focus bullseye(15), rapid_killing, trueshot
2:46.207 aimed_shot Fluffy_Pillow 54.4/150: 36% focus rapid_killing, trueshot
2:47.475 Waiting 0.600 sec 21.4/150: 14% focus rapid_killing, trueshot
2:48.075 marked_shot Fluffy_Pillow 30.9/150: 21% focus rapid_killing, trueshot
2:49.027 aimed_shot Fluffy_Pillow 13.0/150: 9% focus lock_and_load(2), rapid_killing, trueshot
2:49.981 sidewinders Fluffy_Pillow 28.1/150: 19% focus lock_and_load, rapid_killing, trueshot
2:50.933 marked_shot Fluffy_Pillow 90.1/150: 60% focus raid_movement, lock_and_load, marking_targets, rapid_killing, trueshot
2:51.885 Waiting 0.700 sec 75.2/150: 50% focus raid_movement, lock_and_load, marking_targets, rapid_killing, trueshot
2:52.585 windburst Fluffy_Pillow 83.3/150: 56% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:53.538 aimed_shot Fluffy_Pillow 78.3/150: 52% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:54.490 aimed_shot Fluffy_Pillow 90.4/150: 60% focus marking_targets, rapid_killing, trueshot
2:55.759 aimed_shot Fluffy_Pillow 59.3/150: 40% focus marking_targets
2:57.535 sidewinders Fluffy_Pillow 26.3/150: 18% focus marking_targets
2:58.865 aimed_shot Fluffy_Pillow 88.4/150: 59% focus
3:00.640 aimed_shot Fluffy_Pillow 58.4/150: 39% focus
3:02.415 Waiting 0.500 sec 25.5/150: 17% focus marking_targets
3:02.915 marked_shot Fluffy_Pillow 31.1/150: 21% focus marking_targets
3:04.246 Waiting 0.500 sec 13.1/150: 9% focus marking_targets
3:04.746 sidewinders Fluffy_Pillow 18.8/150: 13% focus marking_targets
3:06.325 aimed_shot Fluffy_Pillow 86.6/150: 58% focus
3:08.004 marked_shot Fluffy_Pillow 102.6/150: 68% focus raid_movement, bullseye(5), marking_targets
3:09.336 aimed_shot Fluffy_Pillow 84.6/150: 56% focus bullseye(15), marking_targets
3:11.111 aimed_shot Fluffy_Pillow 54.7/150: 36% focus bullseye(15), marking_targets
3:12.883 Waiting 0.400 sec 21.7/150: 14% focus bullseye(15), marking_targets
3:13.283 windburst Fluffy_Pillow 26.2/150: 17% focus bullseye(15), marking_targets
3:14.865 Waiting 0.500 sec 21.1/150: 14% focus bullseye(15), marking_targets
3:15.365 sidewinders Fluffy_Pillow 26.8/150: 18% focus marking_targets
3:16.947 aimed_shot Fluffy_Pillow 94.6/150: 63% focus
3:18.720 aimed_shot Fluffy_Pillow 61.7/150: 41% focus
3:20.052 marked_shot Fluffy_Pillow 73.7/150: 49% focus raid_movement
3:21.383 Waiting 2.200 sec 58.7/150: 39% focus raid_movement
3:23.583 aimed_shot Fluffy_Pillow 80.6/150: 54% focus
3:24.915 Waiting 1.200 sec 95.6/150: 64% focus raid_movement
3:26.115 aimed_shot Fluffy_Pillow 106.2/150: 71% focus
3:27.890 Waiting 0.600 sec 73.2/150: 49% focus
3:28.490 aimed_shot Fluffy_Pillow 80.0/150: 53% focus
3:30.264 Waiting 0.100 sec 50.1/150: 33% focus
3:30.364 sidewinders Fluffy_Pillow 48.2/150: 32% focus marking_targets
3:31.695 aimed_shot Fluffy_Pillow 113.2/150: 75% focus
3:33.469 aimed_shot Fluffy_Pillow 80.3/150: 54% focus marking_targets
3:35.244 windburst Fluffy_Pillow 50.3/150: 34% focus marking_targets
3:36.577 marked_shot Fluffy_Pillow 42.4/150: 28% focus marking_targets
3:37.907 sidewinders Fluffy_Pillow 27.4/150: 18% focus bullseye(5), marking_targets
3:39.240 aimed_shot Fluffy_Pillow 89.5/150: 60% focus bullseye(15)
3:40.572 Waiting 0.600 sec 104.5/150: 70% focus raid_movement, bullseye(15)
3:41.172 aimed_shot Fluffy_Pillow 108.3/150: 72% focus bullseye(15)
3:42.946 marked_shot Fluffy_Pillow 78.3/150: 52% focus bullseye(15)
3:44.278 aimed_shot Fluffy_Pillow 60.4/150: 40% focus bullseye(15), marking_targets
3:46.051 Waiting 1.200 sec 30.4/150: 20% focus marking_targets
3:47.251 sidewinders Fluffy_Pillow 41.0/150: 27% focus marking_targets
3:48.812 aimed_shot Fluffy_Pillow 108.6/150: 72% focus
3:50.144 marked_shot Fluffy_Pillow 120.6/150: 80% focus raid_movement
3:51.475 Waiting 2.100 sec 105.7/150: 70% focus raid_movement
3:53.575 aimed_shot Fluffy_Pillow 126.4/150: 84% focus
3:55.349 Waiting 1.800 sec 93.4/150: 62% focus
3:57.149 windburst Fluffy_Pillow 110.8/150: 74% focus
3:58.479 aimed_shot Fluffy_Pillow 105.8/150: 71% focus
4:00.253 aimed_shot Fluffy_Pillow 72.8/150: 49% focus marking_targets
4:02.028 blood_fury Fluffy_Pillow 42.9/150: 29% focus marking_targets
4:02.028 sidewinders Fluffy_Pillow 42.9/150: 29% focus blood_fury, marking_targets
4:03.359 aimed_shot Fluffy_Pillow 104.9/150: 70% focus blood_fury
4:05.133 aimed_shot Fluffy_Pillow 72.0/150: 48% focus blood_fury
4:06.907 marked_shot Fluffy_Pillow 42.0/150: 28% focus blood_fury
4:08.239 Waiting 0.300 sec 24.1/150: 16% focus blood_fury, bullseye(20), marking_targets
4:08.539 sidewinders Fluffy_Pillow 27.5/150: 18% focus blood_fury, bullseye(20), marking_targets
4:10.058 potion Fluffy_Pillow 94.6/150: 63% focus blood_fury, bullseye(25)
4:10.058 aimed_shot Fluffy_Pillow 94.6/150: 63% focus blood_fury, bullseye(25), potion_of_deadly_grace
4:11.833 aimed_shot Fluffy_Pillow 61.7/150: 41% focus blood_fury, bullseye(25), potion_of_deadly_grace
4:13.165 Waiting 0.600 sec 73.7/150: 49% focus blood_fury, bullseye(25), potion_of_deadly_grace
4:13.765 marked_shot Fluffy_Pillow 80.5/150: 54% focus blood_fury, bullseye(25), potion_of_deadly_grace
4:15.096 aimed_shot Fluffy_Pillow 65.5/150: 44% focus blood_fury, potion_of_deadly_grace
4:16.871 Waiting 1.400 sec 32.6/150: 22% focus blood_fury, marking_targets, potion_of_deadly_grace
4:18.271 windburst Fluffy_Pillow 45.4/150: 30% focus marking_targets, potion_of_deadly_grace
4:19.808 sidewinders Fluffy_Pillow 42.8/150: 29% focus marking_targets, potion_of_deadly_grace
4:21.139 marked_shot Fluffy_Pillow 104.8/150: 70% focus raid_movement, potion_of_deadly_grace
4:22.471 Waiting 1.200 sec 89.8/150: 60% focus raid_movement, potion_of_deadly_grace
4:23.671 aimed_shot Fluffy_Pillow 100.4/150: 67% focus potion_of_deadly_grace
4:25.445 Waiting 1.700 sec 70.4/150: 47% focus potion_of_deadly_grace
4:27.145 aimed_shot Fluffy_Pillow 86.6/150: 58% focus potion_of_deadly_grace
4:28.477 Waiting 0.700 sec 101.7/150: 68% focus raid_movement, potion_of_deadly_grace
4:29.177 aimed_shot Fluffy_Pillow 106.6/150: 71% focus potion_of_deadly_grace
4:30.952 Waiting 0.300 sec 76.7/150: 51% focus potion_of_deadly_grace
4:31.252 aimed_shot Fluffy_Pillow 80.0/150: 53% focus potion_of_deadly_grace
4:33.026 sidewinders Fluffy_Pillow 47.1/150: 31% focus marking_targets, potion_of_deadly_grace
4:34.357 aimed_shot Fluffy_Pillow 109.1/150: 73% focus marking_targets, potion_of_deadly_grace
4:36.132 aimed_shot Fluffy_Pillow 79.2/150: 53% focus marking_targets, potion_of_deadly_grace
4:37.906 marked_shot Fluffy_Pillow 96.2/150: 64% focus bullseye(5), lock_and_load, marking_targets, potion_of_deadly_grace
4:39.237 aimed_shot Fluffy_Pillow 81.2/150: 54% focus bullseye(20), lock_and_load, marking_targets, potion_of_deadly_grace
4:40.567 windburst Fluffy_Pillow 93.3/150: 62% focus bullseye(25), marking_targets
4:41.899 aimed_shot Fluffy_Pillow 88.3/150: 59% focus bullseye(25), marking_targets
4:43.674 aimed_shot Fluffy_Pillow 55.4/150: 37% focus bullseye(25), marking_targets
4:45.005 sidewinders Fluffy_Pillow 67.4/150: 45% focus raid_movement, bullseye(25), marking_targets
4:46.336 aimed_shot Fluffy_Pillow 132.4/150: 88% focus
4:48.112 aimed_shot Fluffy_Pillow 99.5/150: 66% focus
4:49.886 Waiting 0.200 sec 69.5/150: 46% focus
4:50.086 marked_shot Fluffy_Pillow 68.8/150: 46% focus raid_movement
4:51.418 Waiting 1.300 sec 53.9/150: 36% focus raid_movement
4:52.718 sidewinders Fluffy_Pillow 65.5/150: 44% focus raid_movement, lock_and_load(2), marking_targets
4:54.049 aimed_shot Fluffy_Pillow 130.6/150: 87% focus lock_and_load(2)
4:55.381 aimed_shot Fluffy_Pillow 142.6/150: 95% focus lock_and_load
4:56.712 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
4:58.487 marked_shot Fluffy_Pillow 100.1/150: 67% focus
4:59.819 aimed_shot Fluffy_Pillow 85.1/150: 57% focus
5:01.149 aimed_shot Fluffy_Pillow 97.1/150: 65% focus
5:02.923 windburst Fluffy_Pillow 67.2/150: 45% focus
5:04.255 aimed_shot Fluffy_Pillow 59.2/150: 39% focus
5:06.028 Waiting 2.200 sec 26.2/150: 17% focus
5:08.228 aimed_shot Fluffy_Pillow 51.1/150: 34% focus
5:10.002 Waiting 1.400 sec 18.1/150: 12% focus bullseye(5)
5:11.402 sidewinders Fluffy_Pillow 31.0/150: 21% focus bullseye(5)
5:12.733 aimed_shot Fluffy_Pillow 96.0/150: 64% focus bullseye(5)
5:14.508 aimed_shot Fluffy_Pillow 63.0/150: 42% focus bullseye(5), marking_targets
5:16.006 sidewinders Fluffy_Pillow 80.0/150: 53% focus raid_movement, marking_targets
5:17.338 aimed_shot Fluffy_Pillow 142.0/150: 95% focus
5:19.111 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
5:20.885 Waiting 0.200 sec 67.1/150: 45% focus
5:21.085 marked_shot Fluffy_Pillow 69.3/150: 46% focus
5:22.418 aimed_shot Fluffy_Pillow 51.4/150: 34% focus
5:24.193 windburst Fluffy_Pillow 21.4/150: 14% focus
5:25.582 Waiting 3.500 sec 14.1/150: 9% focus
5:29.082 aimed_shot Fluffy_Pillow 50.7/150: 34% focus
5:30.855 sidewinders Fluffy_Pillow 17.7/150: 12% focus marking_targets
5:32.186 Waiting 1.000 sec 82.7/150: 55% focus raid_movement
5:33.186 aimed_shot Fluffy_Pillow 91.0/150: 61% focus
5:34.959 aimed_shot Fluffy_Pillow 61.1/150: 41% focus
5:36.734 marked_shot Fluffy_Pillow 78.1/150: 52% focus bullseye(3), lock_and_load, marking_targets
5:38.066 aimed_shot Fluffy_Pillow 60.2/150: 40% focus bullseye(7), lock_and_load, marking_targets
5:39.400 aimed_shot Fluffy_Pillow 75.2/150: 50% focus bullseye(8), marking_targets
5:41.172 sidewinders Fluffy_Pillow 42.3/150: 28% focus bullseye(10), marking_targets
5:42.505 aimed_shot Fluffy_Pillow 107.3/150: 72% focus bullseye(12)
5:44.278 aimed_shot Fluffy_Pillow 74.3/150: 50% focus bullseye(14), marking_targets
5:46.052 windburst Fluffy_Pillow 41.4/150: 28% focus bullseye(17), marking_targets
5:47.385 marked_shot Fluffy_Pillow 36.4/150: 24% focus bullseye(24), marking_targets
5:48.715 sidewinders Fluffy_Pillow 18.5/150: 12% focus raid_movement, bullseye(28), marking_targets
5:50.048 trueshot Fluffy_Pillow 83.5/150: 56% focus bullseye(29)
5:50.048 aimed_shot Fluffy_Pillow 83.5/150: 56% focus bullseye(29), rapid_killing, trueshot
5:51.318 aimed_shot Fluffy_Pillow 50.6/150: 34% focus bullseye(30), rapid_killing, trueshot
5:52.588 Waiting 0.800 sec 20.7/150: 14% focus bullseye(30), rapid_killing, trueshot
5:53.388 marked_shot Fluffy_Pillow 30.4/150: 20% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:54.341 Waiting 0.400 sec 15.4/150: 10% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:54.741 sidewinders Fluffy_Pillow 21.7/150: 14% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:55.899 aimed_shot Fluffy_Pillow 87.1/150: 58% focus bullseye(30), rapid_killing, trueshot
5:57.168 aimed_shot Fluffy_Pillow 54.1/150: 36% focus bullseye(30), rapid_killing, trueshot
5:58.436 Waiting 0.600 sec 24.2/150: 16% focus bullseye(30), rapid_killing, trueshot
5:59.036 marked_shot Fluffy_Pillow 30.7/150: 20% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:59.987 Waiting 0.600 sec 15.7/150: 10% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:00.587 aimed_shot Fluffy_Pillow 22.2/150: 15% focus bullseye(30), lock_and_load(2), marking_targets, rapid_killing, trueshot
6:01.541 aimed_shot Fluffy_Pillow 37.3/150: 25% focus bullseye(30), lock_and_load, marking_targets, rapid_killing, trueshot
6:02.495 blood_fury Fluffy_Pillow 49.4/150: 33% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:02.495 Waiting 0.100 sec 49.4/150: 33% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot
6:02.595 aimed_shot Fluffy_Pillow 51.0/150: 34% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot
6:03.862 Waiting 1.500 sec 21.0/150: 14% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot
6:05.362 sidewinders Fluffy_Pillow 40.3/150: 27% focus blood_fury, bullseye(30), marking_targets
6:06.898 aimed_shot Fluffy_Pillow 104.7/150: 70% focus blood_fury, bullseye(30)
6:08.672 windburst Fluffy_Pillow 74.7/150: 50% focus blood_fury, bullseye(30)
6:10.001 aimed_shot Fluffy_Pillow 66.7/150: 44% focus blood_fury, bullseye(30), marking_targets
6:11.777 Waiting 1.500 sec 33.8/150: 23% focus blood_fury, bullseye(30), marking_targets
6:13.277 aimed_shot Fluffy_Pillow 50.7/150: 34% focus blood_fury, bullseye(30), marking_targets
6:15.052 Waiting 1.100 sec 17.8/150: 12% focus blood_fury, bullseye(30), marking_targets
6:16.152 marked_shot Fluffy_Pillow 30.2/150: 20% focus blood_fury, bullseye(30), marking_targets
6:17.484 sidewinders Fluffy_Pillow 12.3/150: 8% focus blood_fury, bullseye(30), marking_targets
6:18.814 aimed_shot Fluffy_Pillow 77.3/150: 52% focus bullseye(30)
6:20.145 Waiting 1.000 sec 89.3/150: 60% focus raid_movement, bullseye(30), marking_targets
6:21.145 aimed_shot Fluffy_Pillow 100.6/150: 67% focus bullseye(30), marking_targets
6:22.920 marked_shot Fluffy_Pillow 67.7/150: 45% focus bullseye(30), marking_targets
6:24.252 aimed_shot Fluffy_Pillow 52.7/150: 35% focus bullseye(30), marking_targets
6:26.026 sidewinders Fluffy_Pillow 19.7/150: 13% focus bullseye(30), marking_targets
6:27.357 aimed_shot Fluffy_Pillow 84.8/150: 57% focus bullseye(30)
6:29.131 aimed_shot Fluffy_Pillow 51.8/150: 35% focus bullseye(30), marking_targets
6:30.906 Waiting 0.100 sec 18.9/150: 13% focus bullseye(30), marking_targets
6:31.006 windburst Fluffy_Pillow 20.0/150: 13% focus bullseye(30), marking_targets
6:32.338 Waiting 4.200 sec 15.1/150: 10% focus bullseye(30), marking_targets
6:36.538 marked_shot Fluffy_Pillow 56.5/150: 38% focus raid_movement, bullseye(30), marking_targets
6:37.871 sidewinders Fluffy_Pillow 41.6/150: 28% focus bullseye(30), marking_targets
6:39.202 aimed_shot Fluffy_Pillow 103.6/150: 69% focus bullseye(30)
6:40.976 aimed_shot Fluffy_Pillow 120.6/150: 80% focus bullseye(30), lock_and_load
6:42.309 Waiting 0.600 sec 135.7/150: 90% focus bullseye(30)
6:42.909 marked_shot Fluffy_Pillow 142.5/150: 95% focus bullseye(30)
6:44.242 aimed_shot Fluffy_Pillow 124.5/150: 83% focus bullseye(30)
6:46.016 aimed_shot Fluffy_Pillow 94.6/150: 63% focus bullseye(30)
6:47.790 sidewinders Fluffy_Pillow 61.6/150: 41% focus bullseye(30)
6:49.122 aimed_shot Fluffy_Pillow 123.7/150: 82% focus bullseye(30), lock_and_load(2), marking_targets
6:50.455 aimed_shot Fluffy_Pillow 138.7/150: 92% focus bullseye(30), lock_and_load, marking_targets

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6234 6234 0
Agility 25010 23645 13493 (10180)
Stamina 34418 34418 21497
Intellect 6003 6003 0
Spirit 2 2 0
Health 2065080 2065080 0
Focus 150 150 0
Crit 20.73% 20.73% 2005
Haste 12.97% 12.97% 4215
Damage / Heal Versatility 1.94% 1.94% 775
Attack Power 25010 23645 0
Mastery 25.01% 25.01% 11202
Armor 2603 2603 2603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 860.00
Local Head Greyed Dragonscale Coif
ilevel: 870, stats: { 358 Armor, +2344 Sta, +1563 AgiInt, +794 Mastery, +613 Crit }
Local Neck Wolfstride Pendant
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 850, stats: { 310 Armor, +1459 Sta, +973 AgiInt, +658 Mastery, +322 Haste }, gems: { +150 Mastery }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Mountainforged Chain Hauberk
ilevel: 850, stats: { 414 Armor, +1945 Sta, +1297 AgiInt, +654 Haste, +654 Mastery }
Local Waist Roar of the Seven Lions
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 Agi, +662 Haste, +496 Mastery }
Local Legs Leggings of Biting Links
ilevel: 855, stats: { 368 Armor, +2038 Sta, +1359 AgiInt, +921 Mastery, +409 Vers }
Local Feet Black Venom Sabatons
ilevel: 865, stats: { 298 Armor, +1678 Sta, +1119 AgiInt, +718 Haste, +317 Mastery }
Local Wrists Ley Dragoon's Wristbraces
ilevel: 865, stats: { 190 Armor, +839 AgiInt, +1258 Sta, +505 Mastery, +272 Haste }
Local Hands Ley Dragoon's Gloves
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +595 Mastery, +421 Haste }
Local Finger1 Empowered Ring of the Kirin Tor
ilevel: 850, stats: { +1094 Sta, +1180 Mastery, +655 Crit }, enchant: { +150 Mastery }
Local Finger2 Nightborne Signet Ring
ilevel: 855, stats: { +1147 Sta, +1230 Mastery, +641 Haste }, enchant: { +200 Mastery }
Local Trinket1 Naraxas' Spiked Tongue
ilevel: 860, stats: { +968 Mastery }
Local Trinket2 Twisting Wind
ilevel: 850, stats: { +1233 AgiInt }
Local Back Cape of Valarjar Courage
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +366 Mastery, +366 Vers }, enchant: { +150 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 878, weapon: { 9075 - 9077, 3 }, stats: { +1684 Agi, +2526 Sta, +737 Crit, +707 Mastery }, relics: { +43 ilevels, +42 ilevels, +43 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Sarkul"
origin="https://us.api.battle.net/wow/character/thrall/Sarkul/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/171/133787819-avatar.jpg"
level=110
race=orc
role=attack
position=ranged_back
professions=engineering=707/leatherworking=800
talents=1133131
artifact=55:0:0:0:0:307:1:308:1:310:1:311:1:312:3:313:3:314:2:315:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/volley
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1492/3337
neck=wolfstride_pendant,id=133633,bonus_id=1727/1502/3336,enchant=mark_of_the_hidden_satyr
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1807/1808/1472,gems=150mastery
back=cape_of_valarjar_courage,id=133765,bonus_id=3412/1502/1813,enchant=150agi
chest=mountainforged_chain_hauberk,id=139597
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=ley_dragoons_wristbraces,id=134296,bonus_id=3414/1527/3336
hands=ley_dragoons_gloves,id=134297,bonus_id=3397/1522/3337
waist=roar_of_the_seven_lions,id=137080,bonus_id=1811
legs=leggings_of_biting_links,id=137518,bonus_id=1727/1507/3337
feet=black_venom_sabatons,id=139219,bonus_id=1805/1487
finger1=empowered_ring_of_the_kirin_tor,id=139599,enchant=150mastery
finger2=nightborne_signet_ring,id=134279,bonus_id=3432/1517/3337,enchant=200mastery
trinket1=naraxas_spiked_tongue,id=137349,bonus_id=3412/1512/3336
trinket2=twisting_wind,id=139323,bonus_id=1807/1472
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=137008/139254/136973/0,relic_id=1807:1472/3379:1467:3336/1727:1502:3336/0

# Gear Summary
# gear_ilvl=860.20
# gear_agility=13493
# gear_stamina=21497
# gear_crit_rating=2005
# gear_haste_rating=4215
# gear_mastery_rating=11202
# gear_versatility_rating=775
# gear_armor=2603
summon_pet=cat

Mellarene

Mellarene : 371034 dps, 242351 dps to main target

  • Race: Blood Elf
  • Class: Mage
  • Spec: Fire
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
371034.3 371034.3 455.7 / 0.123% 88071.3 / 23.7% 23.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
16048.3 16048.3 Mana 3.33% 49.9 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mellarene/advanced
Talents
  • 15: Conflagration (Fire Mage)
  • 30: Shimmer
  • 45: Rune of Power
  • 60: Flame On (Fire Mage)
  • 75: Ice Floes
  • 90: Living Bomb (Fire Mage)
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact
Professions
  • alchemy: 296
  • herbalism: 673
Scale Factors for Mellarene Damage Per Second
Int Haste Vers Crit Mastery
Scale Factors 10.31 10.24 9.50 6.35 5.19
Normalized 1.00 0.99 0.92 0.62 0.50
Scale Deltas 1138 1138 1138 1138 1138
Error 0.58 0.57 0.58 0.56 0.57
Gear Ranking
Optimizers
Ranking
  • Int ~= Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=10.31, CritRating=6.35, HasteRating=10.24, MasteryRating=5.19, Versatility=9.50 )

Scale Factors for other metrics

Scale Factors for Mellarene Damage Per Second
Int Haste Vers Crit Mastery
Scale Factors 10.31 10.24 9.50 6.35 5.19
Normalized 1.00 0.99 0.92 0.62 0.50
Scale Deltas 1138 1138 1138 1138 1138
Error 0.58 0.57 0.58 0.56 0.57
Gear Ranking
Optimizers
Ranking
  • Int ~= Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=10.31, CritRating=6.35, HasteRating=10.24, MasteryRating=5.19, Versatility=9.50 )
Scale Factors for Mellarene Priority Target Damage Per Second
Haste Crit Int Vers Mastery
Scale Factors 9.24 7.71 7.09 6.09 4.86
Normalized 1.30 1.09 1.00 0.86 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.22 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Haste > Crit > Int > Vers > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=7.09, CritRating=7.71, HasteRating=9.24, MasteryRating=4.86, Versatility=6.09 )
Scale Factors for Mellarene Damage Per Second (Effective)
Int Haste Vers Crit Mastery
Scale Factors 10.31 10.24 9.50 6.35 5.19
Normalized 1.00 0.99 0.92 0.62 0.50
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=10.31, CritRating=6.35, HasteRating=10.24, MasteryRating=5.19, Versatility=9.50 )
Scale Factors for Mellarene Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for MellareneTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mellarene 371034
Conflagration (_dot) 764 0.2% 99.6 3.87sec 3078 0 Periodic 179.9 1705 0 1705 0.0% 88.1%

Stats details: conflagration_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.62 0.00 179.86 179.86 0.0000 1.9640 306600.38 306600.38 0.00 867.96 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.9 100.00% 1704.66 1 2459 1703.70 1624 1780 306600 306600 0.00
 
 

Action details: conflagration_dot

Static Values
  • id:226757
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.050000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Conflagration (_explosion) 20912 5.6% 69.1 5.64sec 119780 0 Direct 315.1 13852 33644 26271 62.7%  

Stats details: conflagration_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.10 315.05 0.00 0.00 0.0000 0.0000 8276824.94 8276824.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 117.36 37.25% 13851.70 13115 19672 13857.54 13115 16430 1625615 1625615 0.00
crit 197.69 62.75% 33643.85 27017 50657 33591.07 29397 41516 6651210 6651210 0.00
 
 

Action details: conflagration_explosion

Static Values
  • id:205023
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205023
  • name:Conflagration
  • school:fire
  • tooltip:
  • description:Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 10596 2.8% 21.6 5.28sec 193692 0 Direct 21.5 80281 229927 194812 76.5%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.61 21.49 0.00 0.00 0.0000 0.0000 4186566.73 4186566.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.04 23.47% 80281.17 79173 118760 80028.94 0 118760 404844 404844 0.00
crit 16.45 76.53% 229927.02 158346 296899 230145.90 189223 275786 3781723 3781723 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Fire Blast 15034 4.1% 46.0 8.77sec 130990 0 Direct 46.0 0 130989 130989 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.00 46.00 0.00 0.00 0.0000 0.0000 6025809.90 6025809.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 46.00 100.00% 130988.62 94552 177284 130897.48 115341 144938 6025810 6025810 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum ${{$231567s1=1}+1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 28373 7.7% 99.8 3.87sec 114265 61469 Direct 99.6 63133 140078 114461 66.7%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.79 99.62 0.00 0.00 1.8589 0.0000 11402718.66 11402718.66 0.00 61468.52 61468.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.17 33.29% 63133.41 62538 93807 63128.81 62538 67930 2093970 2093970 0.00
crit 66.45 66.71% 140078.48 128829 241554 140028.20 132754 149591 9308748 9308748 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 56014 15.2% 311.1 1.33sec 72186 0 Periodic 692.0 32450 0 32450 0.0% 172.6%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 311.11 0.00 692.05 692.05 0.0000 1.0000 22457654.75 22457654.75 0.00 32450.96 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 692.0 100.00% 32450.05 1108 229466 32622.02 21484 48326 22457655 22457655 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Living Bomb 11891 3.2% 95.9 8.68sec 49000 193172 Periodic 309.8 8353 19696 15166 60.1% 66.2%

Stats details: living_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.88 0.00 309.79 309.79 0.2537 0.8562 4698135.90 4698135.90 0.00 16224.36 193171.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 123.7 39.94% 8353.16 8197 12296 8353.21 8197 9131 1033551 1033551 0.00
crit 186.1 60.06% 19696.12 16886 31662 19679.70 17728 23019 3664585 3664585 0.00
 
 

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:16500.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&buff.combustion.down
Spelldata
  • id:44457
  • name:Living Bomb
  • school:fire
  • tooltip:Causes $w1 Fire damage every $t1 sec. After {$d=0 milliseconds}, the target explodes, causing $w2 Fire damage to the target and all other enemies within $44461A2 yards$?$w3>0[, and spreading Living Bomb][].
  • description:The target becomes a Living Bomb, taking $217694o1 Fire damage over {$217694d=4 seconds}, and then exploding to deal an additional {$44461s2=1} Fire damage to the target and all other enemies within $44461A2 yards. Other enemies hit by this explosion also become a Living Bomb, but this effect cannot spread further.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Living Bomb (_explosion) 63801 17.0% 95.9 8.65sec 262912 0 Direct 514.8 26771 63690 48971 60.1%  

Stats details: living_bomb_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.88 514.76 0.00 0.00 0.0000 0.0000 25208131.80 25208131.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 205.23 39.87% 26770.98 26229 39343 26769.74 26229 29632 5494105 5494105 0.00
crit 309.53 60.13% 63689.74 54032 101309 63603.89 56692 73655 19714027 19714027 0.00
 
 

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:44461
  • name:Living Bomb
  • school:fire
  • tooltip:
  • description:{$@spelldesc44457=The target becomes a Living Bomb, taking $217694o1 Fire damage over {$217694d=4 seconds}, and then exploding to deal an additional {$44461s2=1} Fire damage to the target and all other enemies within $44461A2 yards. Other enemies hit by this explosion also become a Living Bomb, but this effect cannot spread further.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mark of the Hidden Satyr 8794 2.4% 21.9 18.18sec 160926 0 Direct 21.9 84340 206944 160929 62.5%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.91 21.91 0.00 0.00 0.0000 0.0000 3525752.93 3525752.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.22 37.53% 84339.84 81330 121995 84309.31 81330 121995 693578 693578 0.00
crit 13.69 62.47% 206944.26 167540 314137 206740.42 167540 268901 2832175 2832175 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Phoenix Reborn 3440 0.9% 41.9 9.32sec 32796 0 Direct 41.9 17118 42007 32795 63.0%  

Stats details: phoenix_reborn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.91 41.91 0.00 0.00 0.0000 0.0000 1374455.40 1374455.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.51 37.01% 17117.53 16392 24589 17124.66 16392 21174 265503 265503 0.00
crit 26.40 62.99% 42007.11 33768 63316 42036.86 36631 49386 1108952 1108952 0.00
 
 

Action details: phoenix_reborn

Static Values
  • id:215773
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215773
  • name:Phoenix Reborn
  • school:fire
  • tooltip:
  • description:Targets affected by your Ignite have a chance to erupt in flame, taking $215775m1 additional Fire damage and reducing the remaining cooldown on Phoenix's Flame by {$s1=10} sec.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 14991 4.1% 19.6 21.05sec 306469 237734 Direct 19.5 0 307112 307112 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.56 19.52 0.00 0.00 1.2891 0.0000 5994707.80 5994707.80 0.00 237734.29 237734.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 19.52 100.00% 307112.07 202613 379899 307101.35 263678 355764 5994708 5994708 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Phoenix's Flames (_splash) 12262 3.3% 19.5 21.09sec 248229 0 Direct 50.7 0 95612 95612 100.0%  

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.52 50.68 0.00 0.00 0.0000 0.0000 4845301.03 4845301.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 50.68 100.00% 95612.20 70914 126632 95590.12 77360 120300 4845301 4845301 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Pyroblast 76763 20.8% 94.5 4.25sec 325914 252007 Direct 95.3 142072 385374 323087 74.4%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.45 95.28 0.00 0.00 1.2933 0.0000 30783446.11 30783446.11 0.00 252007.29 252007.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.39 25.60% 142072.11 133134 199701 142025.99 133134 163392 3465193 3465193 0.00
crit 70.89 74.40% 385373.55 274256 514230 385420.14 344331 439876 27318253 27318253 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.760000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 14 0.0% 0.1 55.93sec 48870 35172 Direct 0.1 0 48870 48870 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.12 0.12 0.00 0.00 1.3952 0.0000 5733.04 5733.04 0.00 35172.04 35172.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.12 100.00% 48870.16 33771 63320 5250.36 0 63320 5733 5733 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 17410 4.7% 13.1 29.47sec 529463 0 Direct 315.1 11996 28041 21941 62.0%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.06 315.12 0.00 0.00 0.0000 0.0000 6914473.42 6914473.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.79 38.01% 11996.48 11605 17408 11993.05 11605 14399 1437027 1437027 0.00
crit 195.34 61.99% 28040.78 23210 43519 27996.79 24112 35723 5477446 5477446 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Volatile Ichor 29975 8.0% 17.5 22.48sec 681446 0 Direct 58.6 111922 260070 202887 61.4%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.45 58.62 0.00 0.00 0.0000 0.0000 11893248.45 11893248.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.63 38.60% 111921.65 108555 162833 111922.33 108555 149263 2532423 2532423 0.00
crit 35.99 61.40% 260069.54 217110 407081 259817.21 217528 356580 9360825 9360825 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=65033} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:108554.62
  • base_dd_max:108554.62
 
Simple Action Stats Execute Interval
Mellarene
Arcane Torrent 3.8 118.44sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:28730
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:28730
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=3}% of your Mana. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
Combustion 5.3 83.99sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
 
Counterspell 9.8 42.16sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d][].
 
Flame On 5.7 80.74sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.5 52.00sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.47 0.00 0.00 0.00 1.5347 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 40.01% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 5.3 0.0 84.0sec 84.0sec 13.04% 90.78% 104.4(104.4) 5.1

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:13.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 25.6 7.5 14.9sec 11.5sec 30.69% 31.99% 0.0(0.0) 1.2

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:25.04%
  • enhanced_pyrotechnics_2:4.91%
  • enhanced_pyrotechnics_3:0.72%
  • enhanced_pyrotechnics_4:0.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 106.2 0.0 3.8sec 3.8sec 40.95% 47.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:40.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 94.6 0.0 4.2sec 4.2sec 18.37% 98.93% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:18.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 82.3sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 44.1 158.9 9.1sec 2.0sec 70.44% 100.00% 69.3(69.3) 1.1

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:19.35%
  • pyretic_incantation_2:10.47%
  • pyretic_incantation_3:6.12%
  • pyretic_incantation_4:7.78%
  • pyretic_incantation_5:26.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Rune of Power 8.5 0.0 52.1sec 52.1sec 13.72% 13.72% 0.0(0.0) 2.4

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:13.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=10}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mellarene
combustion Mana 5.3 581450.6 110000.0 109997.6 0.0
counterspell Mana 9.8 216593.2 22000.0 21999.7 0.0
fire_blast Mana 46.0 506027.5 11000.0 11000.1 11.9
fireball Mana 99.8 2195434.2 22000.0 22000.0 5.2
living_bomb Mana 18.7 307870.2 16500.0 3211.0 15.3
pyroblast Mana 95.5 2624931.8 27500.0 27791.0 11.7
scorch Mana 0.1 1289.9 11000.0 10995.6 4.4
Resource Gains Type Count Total Average Overflow
arcane_torrent Mana 3.79 122875.74 (1.93%) 32397.43 2285.41 1.83%
mp5_regen Mana 872.62 6238895.11 (98.07%) 7149.61 368834.90 5.58%
Resource RPS-Gain RPS-Loss
Mana 15869.06 16048.28
Combat End Resource Mean Min Max
Mana 1028014.91 895026.00 1100000.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.4%

Procs

Count Interval
Heating Up generated 106.2 3.8sec
Heating Up removed 11.1 32.4sec
IB conversions of HU 44.0 9.1sec
Total Hot Streak procs 94.6 4.2sec
Hot Streak spells used 260.5 1.5sec
Hot Streak spell crits 203.0 2.0sec
Wasted Hot Streak spell crits 2.2 77.8sec
Direct Ignite applications 32.9 41.9sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Mellarene Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Mellarene Damage Per Second
Count 9999
Mean 371034.27
Minimum 305546.13
Maximum 466347.05
Spread ( max - min ) 160800.92
Range [ ( max - min ) / 2 * 100% ] 21.67%
Standard Deviation 23246.7597
5th Percentile 336470.14
95th Percentile 411623.12
( 95th Percentile - 5th Percentile ) 75152.98
Mean Distribution
Standard Deviation 232.4792
95.00% Confidence Intervall ( 370578.62 - 371489.92 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 150
0.1% Error 15079
0.1 Scale Factor Error with Delta=300 4613266
0.05 Scale Factor Error with Delta=300 18453065
0.01 Scale Factor Error with Delta=300 461326627
Priority Target DPS
Sample Data Mellarene Priority Target Damage Per Second
Count 9999
Mean 242350.63
Minimum 213479.29
Maximum 285991.95
Spread ( max - min ) 72512.66
Range [ ( max - min ) / 2 * 100% ] 14.96%
Standard Deviation 8768.0013
5th Percentile 228170.25
95th Percentile 257050.92
( 95th Percentile - 5th Percentile ) 28880.67
Mean Distribution
Standard Deviation 87.6844
95.00% Confidence Intervall ( 242178.77 - 242522.49 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5028
0.1 Scale Factor Error with Delta=300 656273
0.05 Scale Factor Error with Delta=300 2625094
0.01 Scale Factor Error with Delta=300 65627351
DPS(e)
Sample Data Mellarene Damage Per Second (Effective)
Count 9999
Mean 371034.27
Minimum 305546.13
Maximum 466347.05
Spread ( max - min ) 160800.92
Range [ ( max - min ) / 2 * 100% ] 21.67%
Damage
Sample Data Mellarene Damage
Count 9999
Mean 147899561.25
Minimum 115633195.65
Maximum 184406641.73
Spread ( max - min ) 68773446.07
Range [ ( max - min ) / 2 * 100% ] 23.25%
DTPS
Sample Data Mellarene Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mellarene Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mellarene Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mellarene Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mellarene Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mellarene Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MellareneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mellarene Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
7 9.85 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.combustion.down
8 6.46 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
9 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
A 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
B 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
C 5.67 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
0.00 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
D 18.66 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
E 4.40 rune_of_power,if=buff.combustion.down
F 0.00 call_action_list,name=active_talents
G 5.29 combustion
H 1.00 potion,name=deadly_grace
0.00 blood_fury
0.00 berserking
I 3.80 arcane_torrent
J 30.83 pyroblast,if=buff.hot_streak.up
K 20.72 fire_blast,if=buff.heating_up.up
L 11.76 phoenixs_flames
M 0.15 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase
# count action,conditions
0.00 rune_of_power
N 8.69 pyroblast,if=buff.hot_streak.up
O 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
P 5.06 fire_blast,if=!prev_off_gcd.fire_blast
Q 5.16 phoenixs_flames,if=!prev_gcd.phoenixs_flames
0.00 scorch,if=target.health.pct<=25&equipped.132454
R 3.24 fireball
actions.single_target
# count action,conditions
0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
S 2.37 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
T 54.93 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
U 0.00 call_action_list,name=active_talents
V 0.19 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
W 20.04 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
X 0.27 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
Y 114.66 fireball

Sample Sequence

01256EGIKJKCJKJ7KJLJLJLJ8YYTYTYTDYYYWTYYTDWTYYYY7YWTYYYYDWTYWTYTYYYDTYYTYYY7YSDHKGJ8KCJKJKJLJILTYDYYTYTYYDY7YY8NPQNPQTDYYYTYYTDWTYYWTYYY7YDYYYYYYTYDYEGJKJKCJKJKJILJLTDY7YTYTYTDTWYTY8NPQNQDPNRRYYYT7YTDWTYYTYWTYYDYYTYTYEGLKJKCJKJKJ7LJYDYYTYTYTYTWYTY7DWT8PNQRRQYYDYYYWTYYTYYWTYYYTYYTYY7YYEGILKJKCJKJKJMJLTYYTYTWYTYYYTY7Y8PRPNNYYYYYYYYTYY8NPNPCQNPNPRQ

Sample Sequence Table

time name target resources buffs
Pre flask Mellarene 1100000.0/1100000: 100% mana
Pre food Mellarene 1100000.0/1100000: 100% mana
Pre augmentation Mellarene 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:01.337 combustion Fluffy_Pillow 1094560.5/1100000: 100% mana bloodlust, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:01.337 arcane_torrent Fluffy_Pillow 984560.5/1100000: 90% mana bloodlust, combustion, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:01.337 fire_blast Fluffy_Pillow 1017560.5/1100000: 93% mana bloodlust, combustion, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:01.337 pyroblast Fluffy_Pillow 1006560.5/1100000: 92% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:02.366 fire_blast Fluffy_Pillow 996039.0/1100000: 91% mana bloodlust, combustion, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
0:02.366 flame_on Fluffy_Pillow 985039.0/1100000: 90% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:02.366 pyroblast Fluffy_Pillow 985039.0/1100000: 90% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:03.395 fire_blast Fluffy_Pillow 974517.5/1100000: 89% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:03.395 pyroblast Fluffy_Pillow 963517.5/1100000: 88% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.424 counterspell Fluffy_Pillow 952996.0/1100000: 87% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.424 fire_blast Fluffy_Pillow 930996.0/1100000: 85% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.424 pyroblast Fluffy_Pillow 919996.0/1100000: 84% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:05.452 phoenixs_flames Fluffy_Pillow 909458.0/1100000: 83% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:06.481 pyroblast Fluffy_Pillow 926436.5/1100000: 84% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:07.510 phoenixs_flames Fluffy_Pillow 915915.0/1100000: 83% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:08.539 pyroblast Fluffy_Pillow 932893.5/1100000: 85% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:09.565 phoenixs_flames Fluffy_Pillow 922322.5/1100000: 84% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:10.592 pyroblast Fluffy_Pillow 939268.0/1100000: 85% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:11.621 rune_of_power Fluffy_Pillow 928746.5/1100000: 84% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:12.651 Waiting 0.500 sec 945741.5/1100000: 86% mana bloodlust, raid_movement, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:13.151 fireball Fluffy_Pillow 953991.5/1100000: 87% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:14.553 fireball Fluffy_Pillow 955124.5/1100000: 87% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:15.955 pyroblast Fluffy_Pillow 956257.5/1100000: 87% mana bloodlust, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:16.985 fireball Fluffy_Pillow 945752.5/1100000: 86% mana bloodlust, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:18.389 pyroblast Fluffy_Pillow 946918.5/1100000: 86% mana bloodlust, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:19.419 fireball Fluffy_Pillow 936413.5/1100000: 85% mana bloodlust, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:20.448 pyroblast Fluffy_Pillow 953392.0/1100000: 87% mana bloodlust, raid_movement, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
0:21.477 living_bomb Fluffy_Pillow 942870.5/1100000: 86% mana bloodlust, raid_movement, potion_of_deadly_grace
0:22.505 Waiting 1.100 sec 943332.5/1100000: 86% mana bloodlust, raid_movement, potion_of_deadly_grace
0:23.605 fireball Fluffy_Pillow 961482.5/1100000: 87% mana bloodlust
0:25.007 fireball Fluffy_Pillow 962615.5/1100000: 88% mana bloodlust
0:26.410 fireball Fluffy_Pillow 963765.0/1100000: 88% mana bloodlust, enhanced_pyrotechnics
0:27.812 fire_blast Fluffy_Pillow 964898.0/1100000: 88% mana bloodlust, heating_up, pyretic_incantation
0:27.812 pyroblast Fluffy_Pillow 953898.0/1100000: 87% mana bloodlust, hot_streak, pyretic_incantation(2)
0:28.841 Waiting 0.400 sec 943376.5/1100000: 86% mana bloodlust, raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:29.241 fireball Fluffy_Pillow 949976.5/1100000: 86% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:30.644 fireball Fluffy_Pillow 951126.0/1100000: 86% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:32.047 pyroblast Fluffy_Pillow 952275.5/1100000: 87% mana bloodlust, hot_streak, pyretic_incantation(2)
0:33.077 living_bomb Fluffy_Pillow 941770.5/1100000: 86% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:34.105 fire_blast Fluffy_Pillow 942232.5/1100000: 86% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:34.105 pyroblast Fluffy_Pillow 931232.5/1100000: 85% mana bloodlust, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
0:35.133 fireball Fluffy_Pillow 920694.5/1100000: 84% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
0:36.537 fireball Fluffy_Pillow 921860.5/1100000: 84% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
0:37.938 fireball Fluffy_Pillow 922977.0/1100000: 84% mana bloodlust, enhanced_pyrotechnics(2)
0:39.343 fireball Fluffy_Pillow 924159.5/1100000: 84% mana bloodlust, heating_up, pyretic_incantation
0:40.747 counterspell Fluffy_Pillow 925325.5/1100000: 84% mana bloodlust, enhanced_pyrotechnics
0:40.747 fireball Fluffy_Pillow 903325.5/1100000: 82% mana bloodlust, enhanced_pyrotechnics
0:42.149 fire_blast Fluffy_Pillow 904458.5/1100000: 82% mana heating_up, pyretic_incantation
0:42.149 pyroblast Fluffy_Pillow 893458.5/1100000: 81% mana hot_streak, pyretic_incantation(2)
0:43.485 fireball Fluffy_Pillow 888002.5/1100000: 81% mana heating_up
0:44.823 Waiting 0.400 sec 910079.5/1100000: 83% mana raid_movement, heating_up
0:45.223 fireball Fluffy_Pillow 916679.5/1100000: 83% mana heating_up
0:47.047 fireball Fluffy_Pillow 924775.5/1100000: 84% mana heating_up
0:48.869 fireball Fluffy_Pillow 932838.5/1100000: 85% mana enhanced_pyrotechnics
0:50.205 living_bomb Fluffy_Pillow 954882.5/1100000: 87% mana raid_movement, heating_up, pyretic_incantation
0:51.541 fire_blast Fluffy_Pillow 960426.5/1100000: 87% mana raid_movement, heating_up, pyretic_incantation
0:51.541 pyroblast Fluffy_Pillow 949426.5/1100000: 86% mana raid_movement, hot_streak, pyretic_incantation(2)
0:52.879 Waiting 0.700 sec 944003.5/1100000: 86% mana raid_movement, heating_up, pyretic_incantation(3)
0:53.579 fireball Fluffy_Pillow 955553.5/1100000: 87% mana heating_up, pyretic_incantation(3)
0:55.400 fire_blast Fluffy_Pillow 963600.0/1100000: 88% mana heating_up, pyretic_incantation(3)
0:55.400 pyroblast Fluffy_Pillow 952600.0/1100000: 87% mana hot_streak, pyretic_incantation(4)
0:56.738 fireball Fluffy_Pillow 947177.0/1100000: 86% mana hot_streak, pyretic_incantation(5)
0:58.560 pyroblast Fluffy_Pillow 955240.0/1100000: 87% mana hot_streak, pyretic_incantation(5)
0:59.897 fireball Fluffy_Pillow 949800.5/1100000: 86% mana enhanced_pyrotechnics
1:01.234 fireball Fluffy_Pillow 971861.0/1100000: 88% mana enhanced_pyrotechnics
1:03.056 fireball Fluffy_Pillow 979924.0/1100000: 89% mana enhanced_pyrotechnics
1:04.879 living_bomb Fluffy_Pillow 988003.5/1100000: 90% mana heating_up, pyretic_incantation
1:06.216 pyroblast Fluffy_Pillow 993564.0/1100000: 90% mana hot_streak, pyretic_incantation(2)
1:07.553 fireball Fluffy_Pillow 988124.5/1100000: 90% mana heating_up, pyretic_incantation(3)
1:09.375 fireball Fluffy_Pillow 996187.5/1100000: 91% mana heating_up, pyretic_incantation(3)
1:11.196 pyroblast Fluffy_Pillow 1004234.0/1100000: 91% mana hot_streak, pyretic_incantation(4)
1:12.532 fireball Fluffy_Pillow 998778.0/1100000: 91% mana enhanced_pyrotechnics
1:14.355 fireball Fluffy_Pillow 1006857.5/1100000: 92% mana enhanced_pyrotechnics
1:16.006 Waiting 1.200 sec 1034099.0/1100000: 94% mana raid_movement, heating_up, pyretic_incantation
1:17.206 fireball Fluffy_Pillow 1053899.0/1100000: 96% mana heating_up, pyretic_incantation
1:19.029 counterspell Fluffy_Pillow 1061978.5/1100000: 97% mana heating_up, pyretic_incantation
1:19.029 fireball Fluffy_Pillow 1039978.5/1100000: 95% mana heating_up, pyretic_incantation
1:20.366 phoenixs_flames Fluffy_Pillow 1062039.0/1100000: 97% mana raid_movement, enhanced_pyrotechnics
1:21.703 living_bomb Fluffy_Pillow 1084099.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
1:23.039 potion Fluffy_Pillow 1089643.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
1:23.039 fire_blast Fluffy_Pillow 1089643.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
1:23.039 combustion Fluffy_Pillow 1078643.5/1100000: 98% mana raid_movement, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:23.039 pyroblast Fluffy_Pillow 968643.5/1100000: 88% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:24.375 rune_of_power Fluffy_Pillow 963187.5/1100000: 88% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:25.712 fire_blast Fluffy_Pillow 985248.0/1100000: 90% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
1:25.712 flame_on Fluffy_Pillow 974248.0/1100000: 89% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
1:25.712 pyroblast Fluffy_Pillow 974248.0/1100000: 89% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
1:27.050 fire_blast Fluffy_Pillow 968825.0/1100000: 88% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:27.050 pyroblast Fluffy_Pillow 957825.0/1100000: 87% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:28.386 fire_blast Fluffy_Pillow 952369.0/1100000: 87% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:28.386 pyroblast Fluffy_Pillow 941369.0/1100000: 86% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:29.722 phoenixs_flames Fluffy_Pillow 935913.0/1100000: 85% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:31.058 pyroblast Fluffy_Pillow 957957.0/1100000: 87% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:32.394 arcane_torrent Fluffy_Pillow 952501.0/1100000: 87% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:32.394 phoenixs_flames Fluffy_Pillow 985501.0/1100000: 90% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:33.731 pyroblast Fluffy_Pillow 1007561.5/1100000: 92% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:35.069 fireball Fluffy_Pillow 1002138.5/1100000: 91% mana potion_of_deadly_grace
1:36.893 living_bomb Fluffy_Pillow 1010234.5/1100000: 92% mana potion_of_deadly_grace
1:38.230 fireball Fluffy_Pillow 1015795.0/1100000: 92% mana heating_up, pyretic_incantation, potion_of_deadly_grace
1:40.052 fireball Fluffy_Pillow 1023858.0/1100000: 93% mana heating_up, pyretic_incantation, potion_of_deadly_grace
1:41.874 pyroblast Fluffy_Pillow 1031921.0/1100000: 94% mana hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:43.210 fireball Fluffy_Pillow 1026465.0/1100000: 93% mana hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:45.032 pyroblast Fluffy_Pillow 1034528.0/1100000: 94% mana hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:46.369 fireball Fluffy_Pillow 1029088.5/1100000: 94% mana enhanced_pyrotechnics, potion_of_deadly_grace
1:48.003 Waiting 1.200 sec 1056049.5/1100000: 96% mana raid_movement, enhanced_pyrotechnics, potion_of_deadly_grace
1:49.203 fireball Fluffy_Pillow 1075849.5/1100000: 98% mana enhanced_pyrotechnics
1:50.539 living_bomb Fluffy_Pillow 1097893.5/1100000: 100% mana raid_movement, enhanced_pyrotechnics
1:51.875 Waiting 1.700 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics
1:53.575 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
1:55.398 counterspell Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
1:55.398 fireball Fluffy_Pillow 1056082.5/1100000: 96% mana enhanced_pyrotechnics
1:57.221 fireball Fluffy_Pillow 1064162.0/1100000: 97% mana enhanced_pyrotechnics(2)
1:59.042 rune_of_power Fluffy_Pillow 1072208.5/1100000: 97% mana heating_up, pyretic_incantation
2:00.377 pyroblast Fluffy_Pillow 1094236.0/1100000: 99% mana hot_streak, pyretic_incantation(2), rune_of_power
2:01.714 fire_blast Fluffy_Pillow 1088796.5/1100000: 99% mana rune_of_power
2:01.714 phoenixs_flames Fluffy_Pillow 1077796.5/1100000: 98% mana heating_up, pyretic_incantation, rune_of_power
2:03.051 pyroblast Fluffy_Pillow 1099857.0/1100000: 100% mana hot_streak, pyretic_incantation(2), rune_of_power
2:04.390 fire_blast Fluffy_Pillow 1094450.5/1100000: 99% mana raid_movement, rune_of_power
2:04.390 phoenixs_flames Fluffy_Pillow 1083450.5/1100000: 98% mana raid_movement, heating_up, pyretic_incantation, rune_of_power
2:05.726 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(2)
2:07.065 living_bomb Fluffy_Pillow 1094593.5/1100000: 100% mana
2:08.402 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana
2:10.223 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana
2:12.045 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
2:13.868 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(2)
2:15.203 fireball Fluffy_Pillow 1072610.0/1100000: 98% mana heating_up
2:17.025 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up
2:18.848 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation
2:20.185 living_bomb Fluffy_Pillow 1072643.0/1100000: 98% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
2:21.521 fire_blast Fluffy_Pillow 1078187.0/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:21.521 pyroblast Fluffy_Pillow 1067187.0/1100000: 97% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
2:22.856 fireball Fluffy_Pillow 1061714.5/1100000: 97% mana enhanced_pyrotechnics
2:24.679 fireball Fluffy_Pillow 1069794.0/1100000: 97% mana enhanced_pyrotechnics
2:26.502 fire_blast Fluffy_Pillow 1077873.5/1100000: 98% mana heating_up, pyretic_incantation
2:26.502 pyroblast Fluffy_Pillow 1066873.5/1100000: 97% mana hot_streak, pyretic_incantation(2)
2:27.840 fireball Fluffy_Pillow 1061450.5/1100000: 96% mana enhanced_pyrotechnics
2:29.662 fireball Fluffy_Pillow 1069513.5/1100000: 97% mana enhanced_pyrotechnics
2:31.484 fireball Fluffy_Pillow 1077576.5/1100000: 98% mana enhanced_pyrotechnics(2)
2:33.307 counterspell Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics(3)
2:33.307 fireball Fluffy_Pillow 1056082.5/1100000: 96% mana enhanced_pyrotechnics(3)
2:35.130 living_bomb Fluffy_Pillow 1064162.0/1100000: 97% mana heating_up, pyretic_incantation
2:36.466 Waiting 0.700 sec 1069706.0/1100000: 97% mana raid_movement, enhanced_pyrotechnics
2:37.166 fireball Fluffy_Pillow 1081256.0/1100000: 98% mana enhanced_pyrotechnics
2:38.988 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
2:40.811 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics(2)
2:42.634 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
2:44.455 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics
2:46.277 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
2:48.099 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(2)
2:49.436 fireball Fluffy_Pillow 1072626.5/1100000: 98% mana heating_up
2:50.772 living_bomb Fluffy_Pillow 1094670.5/1100000: 100% mana raid_movement, heating_up
2:52.107 Waiting 0.500 sec 1100000.0/1100000: 100% mana raid_movement, heating_up
2:52.607 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up
2:54.429 rune_of_power Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up
2:55.765 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation, rune_of_power
2:55.765 pyroblast Fluffy_Pillow 990000.0/1100000: 90% mana combustion, hot_streak, pyretic_incantation, rune_of_power
2:57.100 fire_blast Fluffy_Pillow 984527.5/1100000: 90% mana combustion, heating_up, pyretic_incantation(2), rune_of_power
2:57.100 pyroblast Fluffy_Pillow 973527.5/1100000: 89% mana combustion, hot_streak, pyretic_incantation(3), rune_of_power
2:58.436 fire_blast Fluffy_Pillow 968071.5/1100000: 88% mana combustion, heating_up, pyretic_incantation(4), rune_of_power
2:58.436 flame_on Fluffy_Pillow 957071.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:58.436 pyroblast Fluffy_Pillow 957071.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:59.771 fire_blast Fluffy_Pillow 951599.0/1100000: 87% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
2:59.771 pyroblast Fluffy_Pillow 940599.0/1100000: 86% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
3:01.106 fire_blast Fluffy_Pillow 935126.5/1100000: 85% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
3:01.106 pyroblast Fluffy_Pillow 924126.5/1100000: 84% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
3:02.443 arcane_torrent Fluffy_Pillow 918687.0/1100000: 84% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
3:02.443 phoenixs_flames Fluffy_Pillow 951687.0/1100000: 87% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
3:03.779 pyroblast Fluffy_Pillow 973731.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
3:05.117 phoenixs_flames Fluffy_Pillow 968308.0/1100000: 88% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
3:06.454 pyroblast Fluffy_Pillow 990368.5/1100000: 90% mana hot_streak, pyretic_incantation(5)
3:07.792 living_bomb Fluffy_Pillow 984945.5/1100000: 90% mana heating_up, pyretic_incantation(5)
3:09.129 Waiting 0.100 sec 990506.0/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(5)
3:09.229 fireball Fluffy_Pillow 992156.0/1100000: 90% mana heating_up, pyretic_incantation(5)
3:11.051 counterspell Fluffy_Pillow 1000219.0/1100000: 91% mana heating_up, pyretic_incantation(5)
3:11.051 fireball Fluffy_Pillow 978219.0/1100000: 89% mana heating_up, pyretic_incantation(5)
3:12.873 pyroblast Fluffy_Pillow 986282.0/1100000: 90% mana hot_streak, pyretic_incantation(5)
3:14.209 fireball Fluffy_Pillow 980826.0/1100000: 89% mana hot_streak, pyretic_incantation(5)
3:16.031 pyroblast Fluffy_Pillow 988889.0/1100000: 90% mana hot_streak, pyretic_incantation(5)
3:17.368 fireball Fluffy_Pillow 983449.5/1100000: 89% mana hot_streak, pyretic_incantation(5)
3:19.190 pyroblast Fluffy_Pillow 991512.5/1100000: 90% mana hot_streak, pyretic_incantation(5)
3:20.527 living_bomb Fluffy_Pillow 986073.0/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation(5)
3:21.864 pyroblast Fluffy_Pillow 991633.5/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation(5)
3:23.201 fire_blast Fluffy_Pillow 986194.0/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(5)
3:23.201 Waiting 0.400 sec 975194.0/1100000: 89% mana raid_movement, hot_streak, pyretic_incantation(5)
3:23.601 fireball Fluffy_Pillow 981794.0/1100000: 89% mana hot_streak, pyretic_incantation(5)
3:24.938 pyroblast Fluffy_Pillow 1003854.5/1100000: 91% mana raid_movement, hot_streak, pyretic_incantation(5)
3:26.273 fireball Fluffy_Pillow 998382.0/1100000: 91% mana heating_up, pyretic_incantation(5)
3:28.096 rune_of_power Fluffy_Pillow 1006461.5/1100000: 91% mana heating_up, pyretic_incantation(5)
3:29.431 pyroblast Fluffy_Pillow 1028489.0/1100000: 93% mana hot_streak, pyretic_incantation(5), rune_of_power
3:30.767 fire_blast Fluffy_Pillow 1023033.0/1100000: 93% mana rune_of_power
3:30.767 phoenixs_flames Fluffy_Pillow 1012033.0/1100000: 92% mana heating_up, pyretic_incantation, rune_of_power
3:32.103 pyroblast Fluffy_Pillow 1034077.0/1100000: 94% mana hot_streak, pyretic_incantation(2), rune_of_power
3:33.440 phoenixs_flames Fluffy_Pillow 1028637.5/1100000: 94% mana rune_of_power
3:34.778 living_bomb Fluffy_Pillow 1050714.5/1100000: 96% mana heating_up, pyretic_incantation, rune_of_power
3:36.114 fire_blast Fluffy_Pillow 1056258.5/1100000: 96% mana heating_up, pyretic_incantation, rune_of_power
3:36.114 pyroblast Fluffy_Pillow 1045258.5/1100000: 95% mana hot_streak, pyretic_incantation(2), rune_of_power
3:37.451 fireball Fluffy_Pillow 1039819.0/1100000: 95% mana heating_up, pyretic_incantation(3), rune_of_power
3:39.273 fireball Fluffy_Pillow 1047882.0/1100000: 95% mana heating_up, pyretic_incantation(3), rune_of_power
3:40.609 Waiting 0.600 sec 1069926.0/1100000: 97% mana raid_movement, enhanced_pyrotechnics
3:41.209 fireball Fluffy_Pillow 1079826.0/1100000: 98% mana enhanced_pyrotechnics
3:43.030 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics
3:44.854 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation
3:46.679 pyroblast Fluffy_Pillow 1078115.5/1100000: 98% mana hot_streak, pyretic_incantation(2)
3:48.016 counterspell Fluffy_Pillow 1072676.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
3:48.016 fireball Fluffy_Pillow 1050676.0/1100000: 96% mana hot_streak, pyretic_incantation(4)
3:49.838 pyroblast Fluffy_Pillow 1058739.0/1100000: 96% mana hot_streak, pyretic_incantation(4)
3:51.175 living_bomb Fluffy_Pillow 1053299.5/1100000: 96% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
3:52.512 fire_blast Fluffy_Pillow 1058860.0/1100000: 96% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
3:52.512 pyroblast Fluffy_Pillow 1047860.0/1100000: 95% mana raid_movement, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:53.848 fireball Fluffy_Pillow 1042404.0/1100000: 95% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
3:55.670 fireball Fluffy_Pillow 1050467.0/1100000: 95% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
3:57.005 pyroblast Fluffy_Pillow 1072494.5/1100000: 97% mana raid_movement, hot_streak, pyretic_incantation(4)
3:58.341 fireball Fluffy_Pillow 1067038.5/1100000: 97% mana heating_up, pyretic_incantation(5)
4:00.165 fire_blast Fluffy_Pillow 1075134.5/1100000: 98% mana heating_up, pyretic_incantation(5)
4:00.165 pyroblast Fluffy_Pillow 1064134.5/1100000: 97% mana hot_streak, pyretic_incantation(5)
4:01.502 fireball Fluffy_Pillow 1058695.0/1100000: 96% mana enhanced_pyrotechnics
4:03.326 fireball Fluffy_Pillow 1066791.0/1100000: 97% mana enhanced_pyrotechnics
4:05.150 living_bomb Fluffy_Pillow 1074887.0/1100000: 98% mana enhanced_pyrotechnics(2)
4:06.723 fireball Fluffy_Pillow 1084341.5/1100000: 99% mana heating_up, pyretic_incantation
4:08.546 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
4:10.370 pyroblast Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation(2)
4:11.707 fireball Fluffy_Pillow 1072659.5/1100000: 98% mana hot_streak, pyretic_incantation(4)
4:13.044 pyroblast Fluffy_Pillow 1094720.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(4)
4:14.381 fireball Fluffy_Pillow 1089280.5/1100000: 99% mana
4:16.203 rune_of_power Fluffy_Pillow 1078066.0/1100000: 98% mana
4:17.539 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, rune_of_power
4:17.539 phoenixs_flames Fluffy_Pillow 990000.0/1100000: 90% mana combustion, enhanced_pyrotechnics, rune_of_power
4:18.875 fire_blast Fluffy_Pillow 1012044.0/1100000: 92% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
4:18.875 pyroblast Fluffy_Pillow 1001044.0/1100000: 91% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
4:20.210 fire_blast Fluffy_Pillow 995571.5/1100000: 91% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power
4:20.210 flame_on Fluffy_Pillow 984571.5/1100000: 90% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power
4:20.210 pyroblast Fluffy_Pillow 984571.5/1100000: 90% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power
4:21.545 fire_blast Fluffy_Pillow 979099.0/1100000: 89% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:21.545 pyroblast Fluffy_Pillow 968099.0/1100000: 88% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5)
4:22.881 fire_blast Fluffy_Pillow 962643.0/1100000: 88% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:22.881 pyroblast Fluffy_Pillow 951643.0/1100000: 87% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5)
4:24.219 counterspell Fluffy_Pillow 946220.0/1100000: 86% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:24.219 phoenixs_flames Fluffy_Pillow 924220.0/1100000: 84% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:25.553 pyroblast Fluffy_Pillow 946231.0/1100000: 86% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5)
4:26.888 fireball Fluffy_Pillow 940758.5/1100000: 86% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:28.226 living_bomb Fluffy_Pillow 962835.5/1100000: 88% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:29.562 fireball Fluffy_Pillow 968379.5/1100000: 88% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:31.384 fireball Fluffy_Pillow 976442.5/1100000: 89% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:33.207 pyroblast Fluffy_Pillow 984522.0/1100000: 90% mana hot_streak, pyretic_incantation(5)
4:34.543 fireball Fluffy_Pillow 979066.0/1100000: 89% mana hot_streak, pyretic_incantation(5)
4:36.366 pyroblast Fluffy_Pillow 987145.5/1100000: 90% mana hot_streak, pyretic_incantation(5)
4:37.702 fireball Fluffy_Pillow 981689.5/1100000: 89% mana hot_streak, pyretic_incantation(5)
4:39.525 pyroblast Fluffy_Pillow 989769.0/1100000: 90% mana hot_streak, pyretic_incantation(5)
4:40.860 fireball Fluffy_Pillow 984296.5/1100000: 89% mana hot_streak, pyretic_incantation(5)
4:42.682 pyroblast Fluffy_Pillow 992359.5/1100000: 90% mana hot_streak, pyretic_incantation(5)
4:44.019 fire_blast Fluffy_Pillow 986920.0/1100000: 90% mana raid_movement, heating_up
4:44.019 Waiting 1.200 sec 975920.0/1100000: 89% mana raid_movement, hot_streak, pyretic_incantation
4:45.219 fireball Fluffy_Pillow 995720.0/1100000: 91% mana hot_streak, pyretic_incantation
4:47.041 pyroblast Fluffy_Pillow 1003783.0/1100000: 91% mana hot_streak, pyretic_incantation
4:48.378 fireball Fluffy_Pillow 998343.5/1100000: 91% mana heating_up
4:50.005 counterspell Fluffy_Pillow 1025189.0/1100000: 93% mana raid_movement, heating_up
4:50.005 living_bomb Fluffy_Pillow 1003189.0/1100000: 91% mana raid_movement, heating_up
4:51.340 fire_blast Fluffy_Pillow 1008716.5/1100000: 92% mana raid_movement, heating_up
4:51.340 pyroblast Fluffy_Pillow 997716.5/1100000: 91% mana raid_movement, hot_streak, pyretic_incantation
4:52.677 Waiting 0.900 sec 992277.0/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(2)
4:53.577 rune_of_power Fluffy_Pillow 1007127.0/1100000: 92% mana heating_up, pyretic_incantation(2)
4:54.913 fire_blast Fluffy_Pillow 1029171.0/1100000: 94% mana heating_up, pyretic_incantation(2), rune_of_power
4:54.913 pyroblast Fluffy_Pillow 1018171.0/1100000: 93% mana hot_streak, pyretic_incantation(3), rune_of_power
4:56.250 phoenixs_flames Fluffy_Pillow 1012731.5/1100000: 92% mana rune_of_power
4:57.587 fireball Fluffy_Pillow 1034792.0/1100000: 94% mana heating_up, pyretic_incantation, rune_of_power
4:59.408 fireball Fluffy_Pillow 1042838.5/1100000: 95% mana heating_up, pyretic_incantation, rune_of_power
5:00.746 phoenixs_flames Fluffy_Pillow 1064915.5/1100000: 97% mana raid_movement, enhanced_pyrotechnics, rune_of_power
5:02.082 fireball Fluffy_Pillow 1086959.5/1100000: 99% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:03.903 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:05.725 living_bomb Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics(2)
5:07.060 fireball Fluffy_Pillow 1083593.5/1100000: 99% mana heating_up, pyretic_incantation
5:08.883 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
5:10.705 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
5:12.527 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
5:12.527 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
5:13.864 fireball Fluffy_Pillow 1061626.5/1100000: 97% mana heating_up
5:15.687 fireball Fluffy_Pillow 1069706.0/1100000: 97% mana heating_up
5:17.024 pyroblast Fluffy_Pillow 1091766.5/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation
5:18.361 fireball Fluffy_Pillow 1086327.0/1100000: 99% mana
5:20.184 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana
5:22.007 fire_blast Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
5:22.007 pyroblast Fluffy_Pillow 1067082.5/1100000: 97% mana hot_streak, pyretic_incantation(2)
5:23.345 fireball Fluffy_Pillow 1061659.5/1100000: 97% mana enhanced_pyrotechnics
5:25.167 fireball Fluffy_Pillow 1069722.5/1100000: 97% mana enhanced_pyrotechnics
5:26.991 fireball Fluffy_Pillow 1077818.5/1100000: 98% mana heating_up, pyretic_incantation
5:28.812 pyroblast Fluffy_Pillow 1078049.5/1100000: 98% mana hot_streak, pyretic_incantation(2)
5:30.147 fireball Fluffy_Pillow 1072577.0/1100000: 98% mana heating_up
5:31.968 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up
5:33.304 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation
5:34.641 fireball Fluffy_Pillow 1094560.5/1100000: 100% mana
5:36.463 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana
5:38.287 counterspell Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation
5:38.287 fireball Fluffy_Pillow 1056099.0/1100000: 96% mana heating_up, pyretic_incantation
5:40.111 fireball Fluffy_Pillow 1064195.0/1100000: 97% mana enhanced_pyrotechnics
5:41.934 rune_of_power Fluffy_Pillow 1072274.5/1100000: 97% mana heating_up, pyretic_incantation
5:43.272 combustion Fluffy_Pillow 1094351.5/1100000: 99% mana enhanced_pyrotechnics, rune_of_power
5:43.272 arcane_torrent Fluffy_Pillow 984351.5/1100000: 89% mana combustion, enhanced_pyrotechnics, rune_of_power
5:43.272 phoenixs_flames Fluffy_Pillow 1017351.5/1100000: 92% mana combustion, enhanced_pyrotechnics, rune_of_power
5:44.608 fire_blast Fluffy_Pillow 1039395.5/1100000: 94% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
5:44.608 pyroblast Fluffy_Pillow 1028395.5/1100000: 93% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
5:45.945 fire_blast Fluffy_Pillow 1022956.0/1100000: 93% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power
5:45.945 flame_on Fluffy_Pillow 1011956.0/1100000: 92% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power
5:45.945 pyroblast Fluffy_Pillow 1011956.0/1100000: 92% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power
5:47.282 fire_blast Fluffy_Pillow 1006516.5/1100000: 92% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power
5:47.282 pyroblast Fluffy_Pillow 995516.5/1100000: 91% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power
5:48.620 fire_blast Fluffy_Pillow 990093.5/1100000: 90% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power
5:48.620 pyroblast Fluffy_Pillow 979093.5/1100000: 89% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), rune_of_power
5:49.955 scorch Fluffy_Pillow 973621.0/1100000: 89% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
5:51.293 pyroblast Fluffy_Pillow 984698.0/1100000: 90% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5)
5:52.631 phoenixs_flames Fluffy_Pillow 979275.0/1100000: 89% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
5:53.967 pyroblast Fluffy_Pillow 1001319.0/1100000: 91% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(5)
5:55.302 fireball Fluffy_Pillow 995846.5/1100000: 91% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
5:57.125 fireball Fluffy_Pillow 1003926.0/1100000: 91% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
5:58.947 pyroblast Fluffy_Pillow 1011989.0/1100000: 92% mana hot_streak, pyretic_incantation(5)
6:00.286 fireball Fluffy_Pillow 1006582.5/1100000: 92% mana hot_streak, pyretic_incantation(5)
6:02.108 pyroblast Fluffy_Pillow 1014645.5/1100000: 92% mana hot_streak, pyretic_incantation(5)
6:03.446 fire_blast Fluffy_Pillow 1009222.5/1100000: 92% mana heating_up
6:03.446 fireball Fluffy_Pillow 998222.5/1100000: 91% mana hot_streak, pyretic_incantation
6:04.784 pyroblast Fluffy_Pillow 1020299.5/1100000: 93% mana raid_movement, hot_streak, pyretic_incantation
6:06.121 fireball Fluffy_Pillow 1014860.0/1100000: 92% mana
6:07.942 fireball Fluffy_Pillow 1022906.5/1100000: 93% mana
6:09.765 fireball Fluffy_Pillow 1030986.0/1100000: 94% mana heating_up, pyretic_incantation
6:11.587 pyroblast Fluffy_Pillow 1039049.0/1100000: 94% mana hot_streak, pyretic_incantation(2)
6:12.923 fireball Fluffy_Pillow 1033593.0/1100000: 94% mana enhanced_pyrotechnics
6:14.746 counterspell Fluffy_Pillow 1041672.5/1100000: 95% mana enhanced_pyrotechnics
6:14.746 fireball Fluffy_Pillow 1019672.5/1100000: 93% mana enhanced_pyrotechnics
6:16.567 rune_of_power Fluffy_Pillow 1027719.0/1100000: 93% mana heating_up, pyretic_incantation
6:17.903 fire_blast Fluffy_Pillow 1049763.0/1100000: 95% mana enhanced_pyrotechnics, rune_of_power
6:17.903 fireball Fluffy_Pillow 1038763.0/1100000: 94% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
6:19.726 fire_blast Fluffy_Pillow 1046842.5/1100000: 95% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
6:19.726 pyroblast Fluffy_Pillow 1035842.5/1100000: 94% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
6:21.062 pyroblast Fluffy_Pillow 1030386.5/1100000: 94% mana raid_movement, hot_streak, pyretic_incantation(4), rune_of_power
6:22.397 fireball Fluffy_Pillow 1024914.0/1100000: 93% mana
6:24.218 fireball Fluffy_Pillow 1032960.5/1100000: 94% mana
6:26.040 fireball Fluffy_Pillow 1041023.5/1100000: 95% mana enhanced_pyrotechnics
6:27.862 fireball Fluffy_Pillow 1049086.5/1100000: 95% mana heating_up, pyretic_incantation
6:29.686 fireball Fluffy_Pillow 1057182.5/1100000: 96% mana enhanced_pyrotechnics
6:31.509 fireball Fluffy_Pillow 1065262.0/1100000: 97% mana heating_up, pyretic_incantation
6:33.331 fireball Fluffy_Pillow 1073325.0/1100000: 98% mana enhanced_pyrotechnics
6:35.154 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
6:36.491 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(2)
6:37.827 fireball Fluffy_Pillow 1094544.0/1100000: 100% mana
6:39.648 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana
6:41.472 rune_of_power Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation
6:42.809 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(2), rune_of_power
6:44.146 fire_blast Fluffy_Pillow 1094560.5/1100000: 100% mana heating_up, pyretic_incantation(3), rune_of_power
6:44.146 pyroblast Fluffy_Pillow 1083560.5/1100000: 99% mana hot_streak, pyretic_incantation(4), rune_of_power
6:45.481 fire_blast Fluffy_Pillow 1078088.0/1100000: 98% mana rune_of_power
6:45.481 flame_on Fluffy_Pillow 1067088.0/1100000: 97% mana heating_up, pyretic_incantation, rune_of_power
6:45.481 phoenixs_flames Fluffy_Pillow 1067088.0/1100000: 97% mana heating_up, pyretic_incantation, rune_of_power
6:46.818 pyroblast Fluffy_Pillow 1089148.5/1100000: 99% mana hot_streak, pyretic_incantation(2), rune_of_power
6:48.157 fire_blast Fluffy_Pillow 1083742.0/1100000: 99% mana heating_up, pyretic_incantation(3), rune_of_power
6:48.157 pyroblast Fluffy_Pillow 1072742.0/1100000: 98% mana hot_streak, pyretic_incantation(4), rune_of_power
6:49.494 fire_blast Fluffy_Pillow 1067302.5/1100000: 97% mana rune_of_power
6:49.494 fireball Fluffy_Pillow 1056302.5/1100000: 96% mana heating_up, pyretic_incantation, rune_of_power
6:51.316 phoenixs_flames Fluffy_Pillow 1064365.5/1100000: 97% mana heating_up, pyretic_incantation, rune_of_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4872 4547 0
Agility 6579 6254 0
Stamina 31137 31137 19635
Intellect 31830 30123 21359 (1929)
Spirit 2 2 0
Health 1868220 1868220 0
Mana 1100000 1100000 0
Spell Power 31830 30123 0
Crit 36.62% 35.55% 10342
Haste 12.57% 12.57% 4086
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 16500 16500 0
Mastery 14.24% 14.24% 3846
Armor 1631 1631 1631
Run Speed 7 0 404

Gear

Source Slot Average Item Level: 853.00
Local Head Hood of Uncanny Perspectives
ilevel: 865, stats: { 223 Armor, +1491 Int, +2237 Sta, +956 Haste, +424 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Bonespeaker Mantle
ilevel: 840, stats: { 188 Armor, +886 Int, +1329 Sta, +674 Crit, +269 Mastery, +404 RunSpeed }
Local Chest Terrorweave Robe
ilevel: 850, stats: { 260 Armor, +1297 Int, +1945 Sta, +876 Crit, +428 Haste }
Local Waist Braided Manastring Cinch
ilevel: 820, stats: { 131 Armor, +736 Int, +1104 Sta, +513 Mastery, +363 Crit }
Local Legs Bonespeaker Leggings
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +915 Crit, +366 Mastery }, gems: { +150 Crit }
Local Feet Norgannon's Foresight
ilevel: 895, stats: { 210 Armor, +2219 Sta, +1479 Int, +662 Haste, +496 Mastery }
Local Wrists Bracers of Tirisgarde
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +490 Crit, +217 Mastery }, gems: { +150 Crit }
Local Hands Gloves of Unseen Evil
ilevel: 840, stats: { 157 Armor, +1329 Sta, +886 Int, +653 Crit, +289 Mastery }
Local Finger1 Nightmare Loop
ilevel: 835, stats: { +952 Sta, +1191 Crit, +546 Haste }, gems: { +150 Crit }, enchant: { +200 Crit }
Local Finger2 Violet Seal of the Archmage
ilevel: 850, stats: { +1094 Sta, +1154 Crit, +682 Mastery }, enchant: { +200 Crit }
Local Trinket1 Twisting Wind
ilevel: 850, stats: { +1233 AgiInt }
Local Trinket2 Unstable Horrorslime
ilevel: 865, stats: { +986 Crit }
Local Back Stormsky Greatcloak
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +437 Crit, +283 Mastery }, gems: { +150 Crit }, enchant: { +200 Int }
Local Main Hand Felo'melorn
ilevel: 875, weapon: { 2079 - 3863, 2.6 }, stats: { +702 Int, +1052 Sta, +307 Haste, +307 Mastery, +8929 Int }, relics: { +40 ilevels, +43 ilevels, +42 ilevels }
Local Off Hand Heart of the Phoenix
ilevel: 875, stats: { +921 Int, +1381 Sta, +558 Haste, +247 Crit }

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Mellarene"
origin="https://us.api.battle.net/wow/character/thrall/Mellarene/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/197/156956101-avatar.jpg"
level=110
race=blood_elf
role=spell
position=back
professions=alchemy=296/herbalism=673
talents=2122111
artifact=54:0:0:0:0:748:1:749:3:751:3:752:2:754:3:755:3:756:3:759:1:762:1:763:1:1340:1
spec=fire

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=hood_of_uncanny_perspectives,id=142150,bonus_id=3453/1477/3336
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=150crit,enchant=mark_of_the_hidden_satyr
shoulders=bonespeaker_mantle,id=134221,bonus_id=3397/42/1502/3336
back=stormsky_greatcloak,id=134202,bonus_id=3474/1808/1507/1674,gems=150crit,enchant=200int
chest=terrorweave_robe,id=121327,bonus_id=3473/1512/3336
wrists=bracers_of_tirisgarde,id=139754,bonus_id=3386/3384,gems=150crit
hands=gloves_of_unseen_evil,id=137506,bonus_id=1726/1492/3337
waist=braided_manastring_cinch,id=139600
legs=bonespeaker_leggings,id=134218,bonus_id=1727/1808/1507/3336,gems=150crit
feet=norgannons_foresight,id=132455,bonus_id=1811
finger1=nightmare_loop,id=121288,bonus_id=3397/1808/1497/3336,gems=150crit,enchant=200crit
finger2=violet_seal_of_the_archmage,id=142460,enchant=200crit
trinket1=twisting_wind,id=139323,bonus_id=1807/1472
trinket2=unstable_horrorslime,id=138224,bonus_id=1805/1487
main_hand=felomelorn,id=128820,bonus_id=730,gem_id=141265/141272/141261/0,relic_id=3473:1502:1674/3474:1512:3336/3473:1507:3336/0
off_hand=heart_of_the_phoenix,id=133959

# Gear Summary
# gear_ilvl=852.50
# gear_stamina=19635
# gear_intellect=21359
# gear_crit_rating=10342
# gear_haste_rating=4086
# gear_mastery_rating=3846
# gear_speed_rating=404
# gear_armor=1631

Zipi

Zipi : 423346 dps, 256492 dps to main target

  • Race: Tauren
  • Class: Paladin
  • Spec: Retribution
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
423346.3 423346.3 434.0 / 0.103% 83676.0 / 19.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 11.91% 56.1 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Zipi/advanced
Talents
  • 15: Execution Sentence (Retribution Paladin)
  • 30: Zeal (Retribution Paladin)
  • 45: Blinding Light
  • 60: Virtue's Blade (Retribution Paladin)
  • 75: Eye for an Eye (Retribution Paladin)
  • 90: Cavalier (Retribution Paladin)
  • 100: Holy Wrath (Retribution Paladin)
  • Talent Calculator
Artifact
Professions
  • mining: 625
  • herbalism: 494
Scale Factors for Zipi Damage Per Second
Str Crit Haste Vers Mastery
Scale Factors 12.09 11.09 10.78 10.67 5.78
Normalized 1.00 0.92 0.89 0.88 0.48
Scale Deltas 1138 1138 1138 1138 1138
Error 0.55 0.55 0.56 0.55 0.54
Gear Ranking
Optimizers
Ranking
  • Str > Crit ~= Haste ~= Vers > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=12.09, CritRating=11.09, HasteRating=10.78, MasteryRating=5.78, Versatility=10.67 )

Scale Factors for other metrics

Scale Factors for Zipi Damage Per Second
Str Crit Haste Vers Mastery
Scale Factors 12.09 11.09 10.78 10.67 5.78
Normalized 1.00 0.92 0.89 0.88 0.48
Scale Deltas 1138 1138 1138 1138 1138
Error 0.55 0.55 0.56 0.55 0.54
Gear Ranking
Optimizers
Ranking
  • Str > Crit ~= Haste ~= Vers > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=12.09, CritRating=11.09, HasteRating=10.78, MasteryRating=5.78, Versatility=10.67 )
Scale Factors for Zipi Priority Target Damage Per Second
Crit Str Vers Haste Mastery
Scale Factors 7.20 7.18 6.57 4.33 4.29
Normalized 1.00 1.00 0.91 0.60 0.60
Scale Deltas 1138 1138 1138 1138 1138
Error 0.18 0.18 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Crit ~= Str > Vers > Haste ~= Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=7.18, CritRating=7.20, HasteRating=4.33, MasteryRating=4.29, Versatility=6.57 )
Scale Factors for Zipi Damage Per Second (Effective)
Str Crit Haste Vers Mastery
Scale Factors 12.09 11.09 10.78 10.67 5.78
Normalized 1.00 0.92 0.89 0.88 0.48
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Str > Crit > Haste > Vers > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=12.09, CritRating=11.09, HasteRating=10.78, MasteryRating=5.78, Versatility=10.67 )
Scale Factors for Zipi Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for ZipiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Zipi 423346
Blade of Justice 34748 8.3% 50.7 7.92sec 274439 258464 Direct 50.7 185169 570816 274436 23.1%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.75 50.75 0.00 0.00 1.0618 0.0000 13926581.94 20473394.61 31.98 258464.46 258464.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.00 76.85% 185169.33 160289 247034 185166.11 171481 195897 7221403 10616146 31.98
crit 11.75 23.15% 570816.13 493689 760866 570747.15 497469 696995 6705179 9857249 31.98
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Strikes an enemy with the Blade of Justice, dealing ${$sw2*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Greater Blessing of Might (blessing_of_might_proc) 32085 7.6% 363.0 2.01sec 35212 0 Direct 270.5 47262 0 47262 0.0%  

Stats details: blessing_of_might_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 363.03 270.47 0.00 0.00 0.0000 0.0000 12782914.52 12782914.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 270.47 100.00% 47262.45 6435 1048711 47235.53 37918 58834 12782915 12782915 0.00
 
 

Action details: blessing_of_might_proc

Static Values
  • id:205729
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205729
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:
  • description:{$@spelldesc203528=Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:30107.18
  • base_dd_max:30107.18
 
Divine Storm 101270 23.7% 40.5 7.28sec 988390 928165 Direct 242.9 132782 270930 164731 23.1%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.49 242.92 0.00 0.00 1.0649 0.0000 40016893.19 40016893.19 0.00 928164.71 928164.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 186.74 76.87% 132782.46 102642 216783 132795.93 127325 137138 24795974 24795974 0.00
crit 56.18 23.13% 270930.13 209390 442237 270946.00 241892 308226 15220919 15220919 0.00
 
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Unleashes a whirl of divine energy, dealing $224239sw1 Holy damage to all nearby enemies.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Execution Sentence 23979 5.7% 16.9 24.68sec 573919 525378 Periodic 16.6 470908 960733 584345 23.2% 20.8%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.86 0.00 16.56 16.56 1.0924 5.0385 9674317.42 9674317.42 0.00 95002.72 525378.38
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.7 76.84% 470908.16 314075 655204 470883.76 429015 528895 5991077 5991077 0.00
crit 3.8 23.16% 960733.40 640713 1336616 945898.57 0 1336616 3683240 3683240 0.00
 
 

Action details: execution_sentence

Static Values
  • id:213757
  • school:holy
  • resource:holy_power
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
Spelldata
  • id:213757
  • name:Execution Sentence
  • school:holy
  • tooltip:Taking $s2 Holy damage when this expires.
  • description:A hammer slowly falls from the sky, dealing $s2 Holy damage after {$d=7 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:11.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:7.00
  • base_tick_time:7.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Judgment 24279 5.8% 44.3 9.06sec 219684 204114 Direct 44.3 177080 361063 219716 23.2%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.27 44.27 0.00 0.00 1.0763 0.0000 9726419.48 9726419.48 0.00 204113.56 204113.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.01 76.82% 177080.37 153859 238182 177101.56 163110 188457 6022113 6022113 0.00
crit 10.26 23.18% 361062.60 313872 485892 361099.53 313872 472700 3704306 3704306 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Judgment (_aoe) 12282 2.9% 44.3 9.06sec 109614 0 Direct 23.0 170050 346841 210972 23.1%  

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.27 23.00 0.00 0.00 0.0000 0.0000 4852336.67 4852336.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.68 76.85% 170050.44 142968 221323 170050.25 150469 199116 3005831 3005831 0.00
crit 5.32 23.15% 346841.11 291655 451499 346097.55 0 451499 1846505 1846505 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 12021 2.9% 116.7 3.43sec 41376 16615 Direct 116.7 33361 68023 41376 23.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.66 116.66 0.00 0.00 2.4903 0.0000 4826993.38 7096137.50 31.98 16615.24 16615.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.68 76.88% 33361.21 27977 44254 33369.29 31833 34875 2991973 4398483 31.98
crit 26.98 23.12% 68023.13 58455 90278 68043.86 60399 77999 1835021 2697654 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 15438 3.6% 29.8 5.28sec 204427 0 Direct 29.8 165001 336502 204426 23.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.84 29.84 0.00 0.00 0.0000 0.0000 6099921.46 8967462.34 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.98 77.01% 165000.59 117301 178885 165019.57 155371 174779 3791706 5574167 31.98
crit 6.86 22.99% 336502.02 272796 364925 336243.95 0 364925 2308216 3393296 31.95
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rend Flesh 2864 0.7% 22.0 18.02sec 52327 0 Periodic 84.4 10990 22413 13632 23.1% 41.6%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.98 0.00 84.38 84.38 0.0000 1.9783 1150232.88 1150232.88 0.00 6890.72 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.9 76.87% 10990.02 5 14918 11000.82 9750 12346 712851 712851 0.00
crit 19.5 23.13% 22413.01 110 30433 22441.68 18372 27464 437381 437381 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:9638.13
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
shield_of_vengeance_proc 9926 2.3% 3.8 119.63sec 1046147 0 Direct 3.7 875842 1788020 1083978 22.8%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.79 3.66 0.00 0.00 0.0000 0.0000 3964248.57 3964248.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.82 77.18% 875842.23 579596 1718068 872944.15 0 1713581 2472036 2472036 0.00
crit 0.83 22.82% 1788019.78 1182377 3495705 1085752.48 0 3495705 1492213 1492213 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:571045.23
  • base_dd_max:571045.23
 
Templar's Verdict 30111 7.3% 35.0 11.56sec 349881 319826 Direct 35.0 281922 575154 349877 23.2%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.97 34.97 0.00 0.00 1.0940 0.0000 12235249.15 12235249.15 0.00 319825.63 319825.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.87 76.82% 281921.61 255345 390085 281497.91 263005 303172 7573827 7573827 0.00
crit 8.10 23.18% 575154.20 520904 795774 574000.47 0 795774 4661422 4661422 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 49235 11.6% 13.3 31.40sec 1469694 1309639 Direct 51.9 208598 425573 258610 23.1%  
Periodic 154.1 32052 65382 39752 23.1% 38.4%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.30 51.89 154.06 154.06 1.1222 1.0000 19543737.73 19543737.73 0.00 115654.37 1309638.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.93 76.95% 208598.25 176374 283026 208665.01 193103 222514 8329073 8329073 0.00
crit 11.96 23.05% 425572.70 359803 577373 425638.25 369204 533319 5090474 5090474 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 118.5 76.90% 32051.92 29848 47896 32048.31 31582 32423 3797233 3797233 0.00
crit 35.6 23.10% 65382.17 60889 97709 65372.22 63658 69013 2326959 2326959 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=0&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Zeal 75106 17.7% 117.5 3.40sec 254792 235936 Direct 289.3 72509 147920 103460 41.0%  

Stats details: zeal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.48 289.32 0.00 0.00 1.0799 0.0000 29932904.99 44004205.66 31.98 235935.53 235935.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 170.57 58.96% 72508.89 21450 153045 72424.13 62861 81082 12368071 18182236 31.98
crit 118.75 41.04% 147919.81 43757 312211 147756.31 124924 173117 17564834 25821969 31.98
 
 

Action details: zeal

Static Values
  • id:217020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:217020
  • name:Zeal
  • school:physical
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Simple Action Stats Execute Interval
Zipi
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Crusade 3.6 125.30sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.64 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:231895
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:holy_power>=5
Spelldata
  • id:231895
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Greater Blessing of Might 1.0 0.00sec

Stats details: greater_blessing_of_might

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: greater_blessing_of_might

Static Values
  • id:203528
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
Spelldata
  • id:203528
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rebuke 13.8 29.59sec

Stats details: rebuke

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rebuke

Static Values
  • id:96231
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96231
  • name:Rebuke
  • school:physical
  • tooltip:
  • description:Interrupts spellcasting and prevents any spell in that school from being cast for {$d=4 seconds}.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Shield of Vengeance 3.8 120.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 3.79 3.79 0.00 0.00 0.0000 0.0000 0.00 2651116.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.91 76.79% 0.00 0 0 0.00 0 0 0 1639810 99.42
crit 0.88 23.21% 0.00 0 0 0.00 0 0 0 1011307 63.00
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 32.82% 0.0(0.0) 1.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chaotic Energy 1.0 115.7 0.0sec 3.4sec 99.38% 99.38% 96.7(96.7) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_chaotic_energy
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:66.50

Stack Uptimes

  • chaotic_energy_1:0.49%
  • chaotic_energy_2:0.49%
  • chaotic_energy_3:0.45%
  • chaotic_energy_4:0.42%
  • chaotic_energy_5:0.39%
  • chaotic_energy_6:1.09%
  • chaotic_energy_7:0.37%
  • chaotic_energy_8:0.37%
  • chaotic_energy_9:0.37%
  • chaotic_energy_10:1.30%
  • chaotic_energy_11:0.37%
  • chaotic_energy_12:0.42%
  • chaotic_energy_13:0.65%
  • chaotic_energy_14:0.38%
  • chaotic_energy_15:0.56%
  • chaotic_energy_16:0.56%
  • chaotic_energy_17:0.56%
  • chaotic_energy_18:0.57%
  • chaotic_energy_19:0.76%
  • chaotic_energy_20:88.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214831
  • name:Chaotic Energy
  • tooltip:Strength or Agility increased by $w3.
  • description:{$@spelldesc214829=Your melee autoattacks grant you Chaotic Energy, increasing your Strength or Agility by {$214831s3=50}, stacking up to {$214831u=20} times. If you do not autoattack an enemy for 4 sec, this effect will decrease by 1 stack every sec.}
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
Crusade 3.6 30.9 125.3sec 10.6sec 26.57% 100.00% 16.5(42.4) 3.5

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.26%
  • crusade_4:3.21%
  • crusade_7:2.28%
  • crusade_10:3.20%
  • crusade_13:4.82%
  • crusade_15:12.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231895
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 130.5sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Shield of Vengeance 3.8 0.0 120.0sec 120.0sec 13.95% 13.95% 0.0(0.0) 3.7

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:13.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
Zeal 1.0 116.5 0.0sec 3.4sec 99.48% 99.14% 114.5(114.5) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_zeal
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • zeal_1:0.83%
  • zeal_2:0.19%
  • zeal_3:98.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217020
  • name:Zeal
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Blessing of Might (blessing_of_might)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_blessing_of_might
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_might_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203528
  • name:Greater Blessing of Might
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zipi
divine_storm Holy Power 40.5 121.5 3.0 3.0 329463.3
execution_sentence Holy Power 16.9 50.6 3.0 3.0 191305.7
templars_verdict Holy Power 35.0 104.9 3.0 3.0 116627.1
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 13.30 60.36 (21.61%) 4.54 6.13 9.22%
zeal Holy Power 117.48 117.48 (42.06%) 1.00 0.00 0.00%
blade_of_justice Holy Power 50.75 101.49 (36.33%) 2.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.70 0.69
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.37 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Zipi Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Zipi Damage Per Second
Count 9999
Mean 423346.30
Minimum 370731.65
Maximum 494026.73
Spread ( max - min ) 123295.08
Range [ ( max - min ) / 2 * 100% ] 14.56%
Standard Deviation 22141.7025
5th Percentile 389524.62
95th Percentile 463041.93
( 95th Percentile - 5th Percentile ) 73517.31
Mean Distribution
Standard Deviation 221.4281
95.00% Confidence Intervall ( 422912.30 - 423780.29 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10508
0.1 Scale Factor Error with Delta=300 4185098
0.05 Scale Factor Error with Delta=300 16740394
0.01 Scale Factor Error with Delta=300 418509857
Priority Target DPS
Sample Data Zipi Priority Target Damage Per Second
Count 9999
Mean 256491.75
Minimum 231667.58
Maximum 282620.94
Spread ( max - min ) 50953.36
Range [ ( max - min ) / 2 * 100% ] 9.93%
Standard Deviation 7243.6925
5th Percentile 244782.35
95th Percentile 268622.79
( 95th Percentile - 5th Percentile ) 23840.44
Mean Distribution
Standard Deviation 72.4405
95.00% Confidence Intervall ( 256349.77 - 256633.73 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 30
0.1% Error 3063
0.1 Scale Factor Error with Delta=300 447923
0.05 Scale Factor Error with Delta=300 1791693
0.01 Scale Factor Error with Delta=300 44792332
DPS(e)
Sample Data Zipi Damage Per Second (Effective)
Count 9999
Mean 423346.30
Minimum 370731.65
Maximum 494026.73
Spread ( max - min ) 123295.08
Range [ ( max - min ) / 2 * 100% ] 14.56%
Damage
Sample Data Zipi Damage
Count 9999
Mean 168732751.37
Minimum 140888252.31
Maximum 197136713.30
Spread ( max - min ) 56248460.99
Range [ ( max - min ) / 2 * 100% ] 16.67%
DTPS
Sample Data Zipi Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zipi Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Zipi Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zipi Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zipi Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zipi Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ZipiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Zipi Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 greater_blessing_of_might
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
6 32.73 auto_attack
7 13.79 rebuke
8 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
0.00 holy_wrath
0.00 avenging_wrath
9 3.79 shield_of_vengeance
A 3.64 crusade,if=holy_power>=5
B 1.00 wake_of_ashes,if=holy_power>=0&time<2
C 16.86 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=holy_power<5
D 0.00 call_action_list,name=VB,if=talent.virtues_blade.enabled
E 0.00 call_action_list,name=DH,if=talent.divine_hammer.enabled
actions.VB
# count action,conditions
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
F 9.78 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
G 9.59 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
H 8.50 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
I 0.98 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
J 12.30 wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
K 21.57 zeal,if=charges=2&holy_power<=4
0.00 crusader_strike,if=charges=2&holy_power<=4
L 50.76 blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
M 44.28 judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
N 13.56 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
0.00 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
O 17.25 templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
P 97.40 zeal,if=holy_power<=4
0.00 crusader_strike,if=holy_power<=4
Q 8.65 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
R 7.15 templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

Sample Sequence

0123569BAC7KLMGKPOPLOMPPL6CKMPPOLPNML6KNPMPLF6KHJFKLMFKPNPL7CMP6PLGPMQ6KLPNPM6PHJFLKCPMPOL67POPM6PLFPQPML6HJFKPCLMPOP6PLM6F7PPNL9PMH6PPHJA8CLMOKPRPLR6PMPLNPMPQL7PQMPL6QPJCMLOKP7RPLM6PNPLPMFPQPLH67JCPMPOLPOM6KL7NKPPMNLPHJC6PMPO7LPOM6KLN6KP9QPLMPH7PJACL6PMGPRPLQM67PLPN6MPLNPMPHLPCJM6GLK7G6KMPNLPN6PMPLFPCPJMG6LOKPRPLCMP7P6LOPMPRPLCJM6GKLGKPMOP9LCP6PMRLP7RPJAMGLKC6PPOLMPOPLOMPPC6LPRMPLIJGMPCL7K

Sample Sequence Table

time name target resources buffs
Pre flask Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre food Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre augmentation Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre greater_blessing_of_might Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power shield_of_vengeance, potion_of_the_old_war
0:01.160 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:01.160 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, potion_of_the_old_war
0:02.057 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:02.057 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:02.871 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy, potion_of_the_old_war
0:03.687 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy, potion_of_the_old_war
0:04.503 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy(2), potion_of_the_old_war
0:05.318 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(7), zeal, shield_of_vengeance, chaotic_energy(2), potion_of_the_old_war
0:06.072 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(7), zeal(2), shield_of_vengeance, chaotic_energy(2), potion_of_the_old_war
0:06.826 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(7), zeal(3), shield_of_vengeance, chaotic_energy(3), potion_of_the_old_war
0:07.581 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(3), potion_of_the_old_war
0:08.335 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(4), potion_of_the_old_war
0:09.303 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(4), potion_of_the_old_war
0:10.058 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(5), potion_of_the_old_war
0:10.930 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(5), potion_of_the_old_war
0:11.684 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:11.784 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:12.004 Waiting 1.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, raid_movement, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:13.104 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, raid_movement, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:14.096 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:14.096 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:14.850 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:15.604 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(6), potion_of_the_old_war
0:16.360 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(7), potion_of_the_old_war
0:17.115 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), potion_of_the_old_war
0:17.869 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), potion_of_the_old_war
0:18.623 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(9), potion_of_the_old_war
0:19.377 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(9), potion_of_the_old_war
0:20.131 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:20.884 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:21.638 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:22.638 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:23.621 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10)
0:23.621 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10)
0:24.377 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10)
0:25.130 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(11)
0:25.885 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(11)
0:26.640 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12)
0:27.394 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12)
0:28.148 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(13)
0:28.902 Waiting 0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(13)
0:29.202 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(13)
0:29.202 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(13)
0:29.956 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(13)
0:30.710 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(14)
0:31.466 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(14)
0:32.394 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(15)
0:33.321 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), chaotic_energy(15)
0:34.250 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(15)
0:35.179 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(16)
0:36.109 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(16)
0:37.038 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), chaotic_energy(17)
0:37.967 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3), chaotic_energy(17)
0:38.894 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, zeal(3), chaotic_energy(18)
0:39.823 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(18)
0:40.753 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3), chaotic_energy(18)
0:40.753 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3), chaotic_energy(18)
0:41.886 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(19)
0:43.093 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(19)
0:44.299 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:45.199 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:45.199 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:46.405 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
0:47.612 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
0:48.820 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:50.025 Waiting 1.300 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:51.325 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:52.712 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:53.920 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
0:53.920 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
0:55.128 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
0:56.334 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
0:57.540 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
0:58.746 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
0:59.954 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:00.954 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:02.324 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:02.324 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:03.530 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:04.737 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:05.944 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:07.150 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:08.357 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:09.563 Waiting 0.500 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:10.063 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:11.270 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:12.477 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:13.682 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:14.889 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:16.097 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:17.304 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:17.304 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:17.304 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:18.510 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:19.717 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:20.923 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:21.923 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:23.299 Waiting 0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:23.599 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:23.599 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:24.806 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:26.011 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:27.219 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:28.427 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:29.633 Waiting 0.200 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:29.833 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:31.201 Waiting 0.300 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:31.501 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:32.915 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:33.015 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:34.428 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:34.428 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:35.633 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:36.840 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:38.047 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:39.255 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:40.460 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:41.667 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:42.874 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:44.081 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:45.286 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:46.491 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:47.699 Waiting 1.500 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:49.199 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:49.199 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:50.406 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:51.614 Waiting 0.700 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:52.314 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:53.695 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:53.695 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:54.901 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:54.901 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:56.106 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:57.312 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:58.519 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:58.619 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:00.026 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:01.232 Waiting 0.700 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:01.932 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:03.311 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:04.516 Waiting 0.700 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
2:05.216 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:05.216 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:06.421 Waiting 0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:06.721 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:08.100 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:09.308 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:10.515 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:10.515 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), shield_of_vengeance, chaotic_energy(20)
2:10.515 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:11.682 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:12.740 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:13.801 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:14.860 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:15.830 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:16.798 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:17.767 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:18.662 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:18.862 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:19.958 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:20.852 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:20.852 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:21.682 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:22.512 Waiting 0.800 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:23.312 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:24.381 Waiting 0.700 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:25.081 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:26.125 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:26.957 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:27.749 Waiting 0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:28.049 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:29.085 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:29.185 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:30.133 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:30.925 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:31.869 Waiting 0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:32.069 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:32.069 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:33.029 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:33.823 Waiting 0.600 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:34.423 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:35.389 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:36.180 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
2:36.380 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
2:37.386 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:37.386 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:38.179 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:38.971 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:39.071 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:40.101 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:40.894 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:42.107 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:43.318 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:44.524 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:45.729 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:46.936 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:47.069 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:48.276 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
2:49.484 Waiting 0.800 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:50.284 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
2:51.731 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
2:52.938 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:52.938 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:54.145 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:55.351 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:56.557 Waiting 2.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:58.757 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:00.144 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:01.350 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:02.556 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:03.760 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:04.965 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:06.171 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:07.379 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:08.585 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:09.791 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:09.791 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:09.791 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:10.998 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:12.203 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:13.409 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:14.616 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:15.822 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:17.028 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:18.234 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:19.439 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:20.645 Waiting 2.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:22.845 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:24.232 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:25.232 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:25.232 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:26.438 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:27.642 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:27.642 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:28.849 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:30.057 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:31.263 Waiting 1.000 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:32.263 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:33.662 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:34.867 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:36.074 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:37.281 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:38.489 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:39.696 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:40.997 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:42.202 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:42.202 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:43.410 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:44.616 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:45.824 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:47.032 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:47.032 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:48.237 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:49.445 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:50.652 Waiting 2.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:52.852 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:54.231 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:54.231 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:55.439 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:56.653 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:57.859 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:57.859 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:59.067 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:00.273 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:01.479 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:02.684 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:03.684 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:05.064 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:06.271 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:07.477 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:08.682 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:08.682 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:09.888 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:11.096 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:11.096 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), shield_of_vengeance, chaotic_energy(20)
4:12.260 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20)
4:13.334 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20)
4:13.334 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20)
4:14.392 Waiting 0.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20)
4:14.492 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20)
4:15.737 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:16.795 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20)
4:17.765 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20)
4:18.734 Waiting 0.600 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:19.334 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:20.393 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(10), zeal(3), chaotic_energy(20)
4:21.288 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, crusade(10), zeal(3), chaotic_energy(20)
4:22.182 Waiting 0.700 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, crusade(13), zeal(3), chaotic_energy(20)
4:22.882 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, crusade(13), zeal(3), chaotic_energy(20)
4:23.944 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:23.944 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:23.944 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:24.774 Waiting 1.700 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:26.474 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:27.454 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:28.283 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, crusade(13), zeal(3), chaotic_energy(20)
4:29.112 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
4:29.212 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:29.212 Waiting 0.300 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:29.512 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:30.516 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:31.309 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:32.209 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:33.201 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:33.993 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:34.785 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:35.785 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:36.822 Waiting 0.500 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:37.322 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:38.319 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:39.112 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:39.906 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:40.906 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:42.340 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:43.547 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
4:44.753 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
4:45.958 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:45.958 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:47.165 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:48.372 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
4:49.578 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:49.578 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:50.784 Waiting 2.800 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
4:53.584 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:53.584 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:54.791 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:55.997 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:57.204 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
4:58.412 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
4:59.617 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:00.824 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), chaotic_energy(20)
5:02.030 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:02.030 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:03.236 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:04.236 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:05.613 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:06.817 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:08.032 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:09.240 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:10.447 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:11.653 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:12.859 Waiting 0.500 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:13.359 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:14.754 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:15.960 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:17.166 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:17.166 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:18.373 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:19.578 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:20.785 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:21.992 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:23.198 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:24.404 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:25.404 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:26.786 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:27.991 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:29.198 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:30.407 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:30.407 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:31.613 Waiting 1.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:33.213 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:33.213 Waiting 0.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:33.813 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:35.202 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:36.408 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:37.614 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:38.818 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:40.025 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:41.231 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:42.438 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:43.645 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:44.852 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:46.058 Waiting 1.000 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:47.058 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:48.436 Waiting 0.800 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
5:49.236 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:49.236 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:50.442 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:51.649 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:52.854 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:54.061 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:55.267 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:56.474 Waiting 0.200 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:56.674 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:58.050 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:59.256 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
6:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:00.462 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:01.669 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:02.876 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:04.083 Waiting 1.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
6:05.183 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:05.183 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:06.390 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:07.669 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:08.875 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:10.083 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:11.289 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:11.289 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:12.498 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:13.705 Waiting 0.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:14.605 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:16.060 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
6:16.060 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20)
6:17.243 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20)
6:18.409 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), chaotic_energy(20)
6:19.469 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20)
6:20.528 Waiting 0.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, crusade(4), zeal(3), chaotic_energy(20)
6:20.628 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, crusade(4), zeal(3), chaotic_energy(20)
6:21.688 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:21.688 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:22.656 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:23.625 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:24.596 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:25.596 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:26.684 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:27.578 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:28.472 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:29.366 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20)
6:30.197 Waiting 1.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20)
6:31.797 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20)
6:32.850 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), zeal(3), chaotic_energy(20)
6:33.679 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:34.599 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:35.391 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:36.181 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
6:36.974 Waiting 0.200 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
6:37.174 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:37.174 Waiting 0.400 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:37.574 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:38.596 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:39.389 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:40.180 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:40.972 Waiting 0.400 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:41.372 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:42.403 Waiting 0.700 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:43.103 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:44.113 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:44.904 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:45.696 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), zeal(3), chaotic_energy(20)
6:46.488 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
6:47.696 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
6:48.901 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
6:50.109 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
6:51.315 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
6:51.315 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 26734 25028 13606 (10599)
Agility 3198 3198 0
Stamina 35185 35185 21537
Intellect 7326 7326 0
Spirit 0 0 0
Health 2111100 2111100 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 26734 25028 0
Crit 23.12% 23.12% 6342
Haste 24.79% 23.63% 7681
Damage / Heal Versatility 1.50% 1.50% 599
Attack Power 26734 25028 0
Mastery 24.36% 24.36% 2884
Armor 4184 4184 4184
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 859.00
Local Head Venom-Fanged Barbute
ilevel: 865, stats: { 573 Armor, +2237 Sta, +1491 StrInt, +779 Haste, +601 Mastery }
Local Neck Pendant of the Watchful Eye
ilevel: 825, stats: { +867 Sta, +1099 Haste, +573 Crit }
Local Shoulders Nightsfall Shoulderplates
ilevel: 870, stats: { 535 Armor, +1172 StrInt, +1758 Sta, +618 Haste, +437 Mastery }
Local Chest Breastplate of Preservation
ilevel: 860, stats: { 698 Armor, +1424 StrInt, +2136 Sta, +939 Crit, +416 Mastery }
Local Waist Chain of Thrayn
ilevel: 895, stats: { 424 Armor, +2219 Sta, +1479 StrInt, +413 Crit, +745 Haste }
Local Legs Wracksoul Legplates
ilevel: 845, stats: { 591 Armor, +1238 StrInt, +1857 Sta, +888 Crit, +393 Haste }
Local Feet Warboots of Smoldering Fury
ilevel: 860, stats: { 480 Armor, +1601 Sta, +1068 StrInt, +661 Haste, +355 Mastery }
Local Wrists Wristclamps of Mad Dreams
ilevel: 870, stats: { 312 Armor, +1319 Sta, +879 StrInt, +481 Crit, +311 Haste }
Local Hands Tarnished Dreamkeeper's Gauntlets
ilevel: 865, stats: { 441 Armor, +1678 Sta, +1119 StrInt, +673 Haste, +362 Mastery }
Local Finger1 An'she's Band
ilevel: 840, stats: { +997 Sta, +1011 Haste, +758 Crit }
Local Finger2 Utgarde Royal Signet
ilevel: 860, stats: { +1201 Sta, +1307 Crit, +599 Vers }
Local Trinket1 Chaos Talisman
ilevel: 840, stats: { +898 Haste }
Local Trinket2 Ursoc's Rending Paw
ilevel: 855, stats: { +1292 Str }
Local Back Evergreen Vinewrap Drape
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +493 Haste, +241 Crit }
Local Main Hand Ashbringer
ilevel: 880, weapon: { 8875 - 13315, 3.6 }, stats: { +1715 Str, +2573 Sta, +742 Crit, +713 Mastery }, relics: { +45 ilevels, +48 ilevels, +37 ilevels }

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Seal of Light (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Zipi"
origin="https://us.api.battle.net/wow/character/thrall/Zipi/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/146/160036754-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=mining=625/herbalism=494
talents=2231223
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:50:3:51:3:53:3:350:1:351:1:353:1:1275:1
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_countless_armies
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/greater_blessing_of_might
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
actions+=/holy_wrath
actions+=/avenging_wrath
actions+=/shield_of_vengeance
actions+=/crusade,if=holy_power>=5
actions+=/wake_of_ashes,if=holy_power>=0&time<2
actions+=/execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=holy_power<5
actions+=/call_action_list,name=VB,if=talent.virtues_blade.enabled
actions+=/call_action_list,name=DH,if=talent.divine_hammer.enabled

actions.DH=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/wake_of_ashes,if=holy_power<=1
actions.DH+=/zeal,if=charges=2&holy_power<=4
actions.DH+=/crusader_strike,if=charges=2&holy_power<=4
actions.DH+=/divine_hammer,if=holy_power<=3
actions.DH+=/judgment
actions.DH+=/consecration
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/zeal,if=holy_power<=4
actions.DH+=/crusader_strike,if=holy_power<=4

actions.VB=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
actions.VB+=/zeal,if=charges=2&holy_power<=4
actions.VB+=/crusader_strike,if=charges=2&holy_power<=4
actions.VB+=/blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions.VB+=/judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
actions.VB+=/consecration
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/zeal,if=holy_power<=4
actions.VB+=/crusader_strike,if=holy_power<=4
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

head=venomfanged_barbute,id=139229,bonus_id=1805/1487
neck=pendant_of_the_watchful_eye,id=137536,bonus_id=1726/1477
shoulders=nightsfall_shoulderplates,id=139060,bonus_id=3432/1532/3337
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1472
chest=breastplate_of_preservation,id=134500,bonus_id=3412/1512/3336
wrists=wristclamps_of_mad_dreams,id=139235,bonus_id=1807/1492/3337
hands=tarnished_dreamkeepers_gauntlets,id=141695,bonus_id=1805/1487
waist=chain_of_thrayn,id=137086,bonus_id=1811
legs=wracksoul_legplates,id=121280,bonus_id=3432/1507/3336
feet=warboots_of_smoldering_fury,id=141437,bonus_id=1472
finger1=anshes_band,id=139103,bonus_id=3473/1502/1674
finger2=utgarde_royal_signet,id=133637,bonus_id=3411/1512/3337
trinket1=chaos_talisman,id=137459,bonus_id=1727/1492/1813
trinket2=ursocs_rending_paw,id=139328,bonus_id=1807/1477/3336
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=141276/141522/141260/0,relic_id=3397:1517:3337/1477:3336/3396:1492:3339/0

# Gear Summary
# gear_ilvl=858.67
# gear_strength=13606
# gear_stamina=21537
# gear_crit_rating=6342
# gear_haste_rating=7681
# gear_mastery_rating=2884
# gear_versatility_rating=599
# gear_armor=4184

Faelik

Faelik : 432102 dps, 294557 dps to main target

  • Race: Undead
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
432101.9 432101.9 447.8 / 0.104% 89641.2 / 20.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.94% 53.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Faelik/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Void Lord (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Power Infusion (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • alchemy: 575
  • herbalism: 800
Scale Factors for Faelik Damage Per Second
Haste Crit Int Mastery Vers
Scale Factors 19.99 14.42 13.28 13.14 10.77
Normalized 1.51 1.09 1.00 0.99 0.81
Scale Deltas 1138 1138 1138 1138 1138
Error 0.56 0.56 0.57 0.57 0.57
Gear Ranking
Optimizers
Ranking
  • Haste > Crit > Int ~= Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=13.28, CritRating=14.42, HasteRating=19.99, MasteryRating=13.14, Versatility=10.77 )

Scale Factors for other metrics

Scale Factors for Faelik Damage Per Second
Haste Crit Int Mastery Vers
Scale Factors 19.99 14.42 13.28 13.14 10.77
Normalized 1.51 1.09 1.00 0.99 0.81
Scale Deltas 1138 1138 1138 1138 1138
Error 0.56 0.56 0.57 0.57 0.57
Gear Ranking
Optimizers
Ranking
  • Haste > Crit > Int ~= Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=13.28, CritRating=14.42, HasteRating=19.99, MasteryRating=13.14, Versatility=10.77 )
Scale Factors for Faelik Priority Target Damage Per Second
Haste Crit Int Mastery Vers
Scale Factors 10.33 10.23 8.94 8.47 7.35
Normalized 1.16 1.15 1.00 0.95 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.20 0.21 0.21 0.21 0.21
Gear Ranking
Optimizers
Ranking
  • Haste ~= Crit > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=8.94, CritRating=10.23, HasteRating=10.33, MasteryRating=8.47, Versatility=7.35 )
Scale Factors for Faelik Damage Per Second (Effective)
Haste Crit Int Mastery Vers
Scale Factors 19.99 14.42 13.28 13.14 10.77
Normalized 1.51 1.09 1.00 0.99 0.81
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Crit > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=13.28, CritRating=14.42, HasteRating=19.99, MasteryRating=13.14, Versatility=10.77 )
Scale Factors for Faelik Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for FaelikTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Faelik 432102
Deadly Grace 9468 2.2% 30.4 13.59sec 123195 0 Direct 30.3 96616 193581 123350 27.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.37 30.33 0.00 0.00 0.0000 0.0000 3741597.84 3741597.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.97 72.43% 96616.30 87722 105266 96602.75 91063 103202 2122711 2122711 0.00
crit 8.36 27.57% 193581.06 175443 210532 193533.55 0 210532 1618887 1618887 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of the Hidden Satyr 10540 2.4% 31.9 12.46sec 132423 0 Direct 31.9 103587 207291 132423 27.8%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.88 31.88 0.00 0.00 0.0000 0.0000 4221895.59 4221895.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.02 72.19% 103587.47 91864 110237 103571.57 96458 109472 2384269 2384269 0.00
crit 8.86 27.81% 207291.04 183729 220475 207285.89 183729 220475 1837627 1837627 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Mind Blast 32455 7.5% 57.6 6.87sec 225613 237735 Direct 58.6 173440 347310 221766 27.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.63 58.63 0.00 0.00 0.9490 0.0000 13002216.34 13002216.34 0.00 237735.25 237735.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.33 72.21% 173440.33 125830 196295 173440.70 162824 184105 7342526 7342526 0.00
crit 16.30 27.79% 347309.93 251660 392589 347315.42 283369 392589 5659690 5659690 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 17020 4.0% 56.3 7.17sec 123863 82365 Periodic 157.7 34580 69294 44230 27.8% 18.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.31 0.00 157.70 157.70 1.5038 0.4674 6974998.01 6974998.01 0.00 82365.00 82365.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 113.9 72.20% 34579.63 25167 39261 34555.56 31627 37813 3937125 3937125 0.00
crit 43.8 27.80% 69294.14 50232 78522 69266.62 58766 78522 3037873 3037873 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mind Sear 43752 10.0% 35.3 8.04sec 489734 345444 Periodic 476.1 28395 56816 36298 27.8% 10.1%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.29 0.00 83.87 476.08 1.4177 0.4833 17280857.58 17280857.58 0.00 345444.43 345444.43
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 343.7 72.19% 28395.21 20590 32121 28407.86 25437 30126 9759390 9759390 0.00
crit 132.4 27.81% 56816.42 41181 64242 56842.07 49551 61201 7521467 7521467 0.00
 
 

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing Shadow damage to all targets within $49821a2 yards.
  • description:Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a2 yards.
  • description:{$@spelldesc48045=Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Death 4889 1.1% 7.9 9.99sec 245847 263648 Direct 7.9 192968 386038 245841 27.4%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.93 7.93 0.00 0.00 0.9326 0.0000 1949416.77 1949416.77 0.00 263648.47 263648.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.76 72.61% 192967.55 153171 199122 193030.61 153171 199122 1111042 1111042 0.00
crit 2.17 27.39% 386037.65 306341 398244 353500.36 0 398244 838374 838374 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 62557 (76030) 14.5% (17.6%) 49.6 7.86sec 611455 657918 Direct 49.6 40681 81665 52014 27.6%  
Periodic 350.7 50008 100194 63966 27.8% 105.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.63 49.63 350.66 350.66 0.9294 1.2027 25011972.37 25011972.37 0.00 64864.40 657917.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.91 72.35% 40681.44 26414 76643 40723.62 33601 47925 1460891 1460891 0.00
crit 13.72 27.65% 81665.21 52828 154934 81744.92 52828 111707 1120735 1120735 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 253.1 72.19% 50008.40 859 88642 50033.80 47046 54202 12658816 12658816 0.00
crit 97.5 27.81% 100194.34 324 177285 100183.25 89669 113934 9771530 9771530 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 13473 3.1% 290.3 1.33sec 18384 0 Direct 384.9 13865 0 13865 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 290.32 384.94 0.00 0.00 0.0000 0.0000 5337109.59 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 384.94 100.00% 13864.77 8162 39218 13876.95 11588 16971 5337110 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 16457 3.8% 176.2 2.25sec 37281 0 Direct 174.8 29185 58418 37581 28.7%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 176.21 174.80 0.00 0.00 0.0000 0.0000 6569091.60 6569091.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 124.60 71.28% 29185.19 20972 32716 29187.58 27496 30603 3636424 3636424 0.00
crit 50.20 28.72% 58418.38 41943 65432 58424.99 52416 63262 2932667 2932667 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Touch of the Grave 3331 0.8% 25.3 16.09sec 52743 0 Direct 25.3 52743 0 52743 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.31 25.31 0.00 0.00 0.0000 0.0000 1334716.49 1334716.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.31 100.00% 52743.14 38130 59483 52749.42 49665 56106 1334716 1334716 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 129846 30.0% 39.1 7.81sec 1320248 1433407 Periodic 472.0 85564 171337 109408 27.8% 207.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.11 0.00 471.98 471.98 0.9211 1.7580 51638481.61 51638481.61 0.00 59644.23 1433406.85
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 340.8 72.20% 85564.03 290 151656 85557.68 76061 92493 29158108 29158108 0.00
crit 131.2 27.80% 171337.20 1370 300217 171283.27 148014 191280 22480374 22480374 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 56813 13.2% 95.1 4.03sec 239210 263158 Direct 94.8 187584 375138 239893 27.9%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.07 94.80 0.00 0.00 0.9090 0.0000 22742132.34 22742132.34 0.00 263158.21 263158.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.36 72.11% 187583.99 125566 195883 187607.06 182602 192671 12823291 12823291 0.00
crit 26.44 27.89% 375137.80 251131 391765 375184.72 353677 391765 9918841 9918841 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 9964 2.3% 10.7 38.03sec 370594 0 Direct 50.3 61598 123150 78710 27.8%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.69 50.32 0.00 0.00 0.0000 0.0000 3961007.81 3961007.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.33 72.20% 61598.09 57197 68636 61623.38 57591 66729 2238051 2238051 0.00
crit 13.99 27.80% 123149.79 114393 137272 123230.05 114393 137272 1722957 1722957 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 14056 3.3% 6.8 61.85sec 832125 269775 Periodic 36.4 121160 242109 154788 27.8% 4.6%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.78 0.00 36.43 36.43 3.0846 0.5079 5638293.82 5638293.82 0.00 269774.82 269774.82
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.3 72.20% 121159.72 363 130865 121287.58 102531 130865 3186260 3186260 0.00
crit 10.1 27.80% 242108.81 1662 261730 242435.53 146743 261730 2452034 2452034 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 108731 / 7482
melee 108731 1.7% 33.3 8.58sec 90205 121808 Direct 33.3 70601 141232 90205 27.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.30 33.30 0.00 0.00 0.7406 0.0000 3003411.89 3003411.89 0.00 121807.68 121807.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.05 72.24% 70601.02 63102 72567 70590.52 68510 72567 1698235 1698235 0.00
crit 9.24 27.76% 141232.49 126203 145134 141187.84 0 145134 1305176 1305176 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Faelik
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Power Infusion 3.6 122.17sec

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.insanity_drain_stacks.stack>=85
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
 
Shadowfiend 2.3 197.77sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.34 0.00 0.00 0.00 0.8964 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Summons a shadowy fiend to attack the target for {$d=12 seconds}.
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - shadowfiend
Shadowcrawl 4.7 74.56sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.65 0.00 0.00 0.00 0.8864 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 9.92% 0.0(0.0) 1.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Burning Intensity 4.7 0.0 73.7sec 73.4sec 22.74% 22.74% 4.4(4.4) 4.4

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_burning_intensity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:337.58

Stack Uptimes

  • burning_intensity_1:1.17%
  • burning_intensity_2:1.16%
  • burning_intensity_3:1.16%
  • burning_intensity_4:1.16%
  • burning_intensity_5:1.15%
  • burning_intensity_6:1.15%
  • burning_intensity_7:1.15%
  • burning_intensity_8:1.14%
  • burning_intensity_9:1.14%
  • burning_intensity_10:1.14%
  • burning_intensity_11:1.14%
  • burning_intensity_12:1.13%
  • burning_intensity_13:1.13%
  • burning_intensity_14:1.13%
  • burning_intensity_15:1.12%
  • burning_intensity_16:1.12%
  • burning_intensity_17:1.12%
  • burning_intensity_18:1.11%
  • burning_intensity_19:1.11%
  • burning_intensity_20:1.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215816
  • name:Burning Intensity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc215813=Your damaging spells have a chance to grant you {$215816s1=319} Critical Strike every $215815t2 sec for {$215815d=20 seconds}.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
insanity_drain_stacks 10.7 267.1 38.0sec 38.0sec 72.51% 72.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.53%
  • insanity_drain_stacks_2:2.66%
  • insanity_drain_stacks_3:2.69%
  • insanity_drain_stacks_4:2.70%
  • insanity_drain_stacks_5:2.66%
  • insanity_drain_stacks_6:2.66%
  • insanity_drain_stacks_7:2.67%
  • insanity_drain_stacks_8:2.64%
  • insanity_drain_stacks_9:2.66%
  • insanity_drain_stacks_10:2.85%
  • insanity_drain_stacks_11:2.78%
  • insanity_drain_stacks_12:2.74%
  • insanity_drain_stacks_13:3.15%
  • insanity_drain_stacks_14:3.00%
  • insanity_drain_stacks_15:2.69%
  • insanity_drain_stacks_16:2.86%
  • insanity_drain_stacks_17:2.84%
  • insanity_drain_stacks_18:2.66%
  • insanity_drain_stacks_19:2.78%
  • insanity_drain_stacks_20:2.58%
  • insanity_drain_stacks_21:2.28%
  • insanity_drain_stacks_22:2.08%
  • insanity_drain_stacks_23:1.67%
  • insanity_drain_stacks_24:1.36%
  • insanity_drain_stacks_25:1.11%
  • insanity_drain_stacks_26:0.91%
  • insanity_drain_stacks_27:0.81%
  • insanity_drain_stacks_28:0.76%
  • insanity_drain_stacks_29:0.74%
  • insanity_drain_stacks_30:0.73%
  • insanity_drain_stacks_31:0.72%
  • insanity_drain_stacks_32:0.68%
  • insanity_drain_stacks_33:0.58%
  • insanity_drain_stacks_34:0.51%
  • insanity_drain_stacks_35:0.46%
  • insanity_drain_stacks_36:0.40%
  • insanity_drain_stacks_37:0.33%
  • insanity_drain_stacks_38:0.26%
  • insanity_drain_stacks_39:0.18%
  • insanity_drain_stacks_40:0.10%
  • insanity_drain_stacks_41:0.04%
  • insanity_drain_stacks_42:0.01%
  • insanity_drain_stacks_43:0.00%
  • insanity_drain_stacks_44:0.00%
  • insanity_drain_stacks_45:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 10.7 0.0 36.1sec 36.1sec 43.21% 90.47% 0.0(0.0) 9.5

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_17:0.01%
  • lingering_insanity_18:0.07%
  • lingering_insanity_19:0.30%
  • lingering_insanity_20:2.40%
  • lingering_insanity_21:5.22%
  • lingering_insanity_22:2.90%
  • lingering_insanity_23:4.10%
  • lingering_insanity_24:2.28%
  • lingering_insanity_25:1.60%
  • lingering_insanity_26:2.22%
  • lingering_insanity_27:2.19%
  • lingering_insanity_28:2.45%
  • lingering_insanity_29:1.79%
  • lingering_insanity_30:1.10%
  • lingering_insanity_31:0.72%
  • lingering_insanity_32:0.30%
  • lingering_insanity_33:0.26%
  • lingering_insanity_34:0.31%
  • lingering_insanity_35:1.35%
  • lingering_insanity_36:2.56%
  • lingering_insanity_37:1.86%
  • lingering_insanity_38:0.56%
  • lingering_insanity_39:0.39%
  • lingering_insanity_40:0.49%
  • lingering_insanity_41:0.83%
  • lingering_insanity_42:1.28%
  • lingering_insanity_43:1.43%
  • lingering_insanity_44:1.31%
  • lingering_insanity_45:0.63%
  • lingering_insanity_46:0.25%
  • lingering_insanity_47:0.05%
  • lingering_insanity_48:0.01%
  • lingering_insanity_49:0.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
mind_sear_on_hit_reset 13.8 21.5 21.2sec 8.0sec 30.05% 30.05% 0.0(0.0) 13.7

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_mind_sear_on_hit_reset
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • mind_sear_on_hit_reset_1:30.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of Deadly Grace 2.0 0.0 363.5sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power Infusion 3.6 0.0 122.1sec 122.1sec 17.46% 17.46% 0.0(0.0) 3.4

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • power_infusion_1:17.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Sphere of Insanity 10.7 0.0 38.0sec 38.0sec 72.51% 75.19% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:72.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 8.5 902.3 29.7sec 0.4sec 66.53% 66.53% 902.3(902.3) 7.5

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:66.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.8 0.0 61.8sec 61.8sec 4.88% 4.88% 0.0(0.0) 3.4

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:4.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 10.7 0.0 38.0sec 38.0sec 72.51% 74.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.66%
  • voidform_2:2.65%
  • voidform_3:2.65%
  • voidform_4:2.64%
  • voidform_5:2.63%
  • voidform_6:2.63%
  • voidform_7:2.62%
  • voidform_8:2.62%
  • voidform_9:2.61%
  • voidform_10:2.60%
  • voidform_11:2.60%
  • voidform_12:2.59%
  • voidform_13:2.58%
  • voidform_14:2.58%
  • voidform_15:2.57%
  • voidform_16:2.56%
  • voidform_17:2.56%
  • voidform_18:2.55%
  • voidform_19:2.54%
  • voidform_20:2.46%
  • voidform_21:2.21%
  • voidform_22:1.97%
  • voidform_23:1.76%
  • voidform_24:1.56%
  • voidform_25:1.45%
  • voidform_26:1.33%
  • voidform_27:1.19%
  • voidform_28:1.04%
  • voidform_29:0.91%
  • voidform_30:0.82%
  • voidform_31:0.77%
  • voidform_32:0.74%
  • voidform_33:0.72%
  • voidform_34:0.70%
  • voidform_35:0.67%
  • voidform_36:0.53%
  • voidform_37:0.42%
  • voidform_38:0.37%
  • voidform_39:0.34%
  • voidform_40:0.32%
  • voidform_41:0.28%
  • voidform_42:0.23%
  • voidform_43:0.16%
  • voidform_44:0.08%
  • voidform_45:0.03%
  • voidform_46:0.01%
  • voidform_47:0.00%
  • voidform_48:0.00%
  • voidform_49:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend: raid_movement 0.4 0.0 0.0sec 0.0sec 5.68% 5.68% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:5.68%

Trigger Attempt Success

  • trigger_pct:43.39%
shadowfiend: Shadowcrawl 4.7 0.0 74.4sec 74.4sec 83.44% 79.16% 0.0(0.0) 4.6

Buff details

  • buff initial source:Faelik_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:83.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Faelik
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 174.80 669.46 (1196.13%) 3.83 29.73 4.25%
Insanity Drained by Voidform Insanity 5807.83 -4459.73 (-7968.21%) -0.77 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 58.63 693.77 (1239.56%) 11.83 9.80 1.39%
Insanity Gained from Mind Flay Insanity 157.70 315.35 (563.43%) 2.00 0.05 0.01%
Insanity Gained from Mind Sear Insanity 476.08 657.33 (1174.46%) 1.38 56.79 7.95%
Insanity Gained from Power Infusion Insanity 259.52 226.56 (404.79%) 0.87 50.42 18.20%
Insanity Gained from Shadow Word: Death Insanity 7.93 77.58 (138.61%) 9.78 1.86 2.35%
Insanity Gained from Shadow Word: Pain Casts Insanity 49.63 148.82 (265.90%) 3.00 0.08 0.05%
Insanity Gained from Vampiric Touch Casts Insanity 39.11 156.43 (279.49%) 4.00 0.02 0.01%
Insanity Gained from Void Bolt Insanity 95.07 1294.83 (2313.47%) 13.62 226.33 14.88%
Insanity Saved by Void Torrent Insanity 389.56 275.58 (492.38%) 0.71 0.00 0.00%
Health from Vampiric Touch Ticks Health 471.98 0.00 (0.00%) 0.00 25819015.43 100.00%
mp5_regen Mana 940.70 0.00 (0.00%) 0.00 3523944.99 100.00%
Resource RPS-Gain RPS-Loss
Insanity 11.26 11.12
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 56.18 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 176.2 2.2sec
Void Eruption casted when a target with both DoTs was up 12.4 38.0sec
Void Eruption casted when a target with no DoTs was up 9.6 45.1sec
Void Eruption casted when a target with only Shadow Word: Pain was up 0.5 105.9sec
Void Eruption casted when a target with only Vampiric Touch was up 25.2 37.6sec

Statistics & Data Analysis

Fight Length
Sample Data Faelik Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Faelik Damage Per Second
Count 9999
Mean 432101.92
Minimum 371979.97
Maximum 517343.54
Spread ( max - min ) 145363.57
Range [ ( max - min ) / 2 * 100% ] 16.82%
Standard Deviation 22846.2658
5th Percentile 398271.07
95th Percentile 473722.70
( 95th Percentile - 5th Percentile ) 75451.63
Mean Distribution
Standard Deviation 228.4741
95.00% Confidence Intervall ( 431654.12 - 432549.72 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10738
0.1 Scale Factor Error with Delta=300 4455681
0.05 Scale Factor Error with Delta=300 17822725
0.01 Scale Factor Error with Delta=300 445568129
Priority Target DPS
Sample Data Faelik Priority Target Damage Per Second
Count 9999
Mean 294557.30
Minimum 262273.67
Maximum 328202.62
Spread ( max - min ) 65928.94
Range [ ( max - min ) / 2 * 100% ] 11.19%
Standard Deviation 8392.1606
5th Percentile 280524.85
95th Percentile 308149.78
( 95th Percentile - 5th Percentile ) 27624.93
Mean Distribution
Standard Deviation 83.9258
95.00% Confidence Intervall ( 294392.81 - 294721.79 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3118
0.1 Scale Factor Error with Delta=300 601216
0.05 Scale Factor Error with Delta=300 2404867
0.01 Scale Factor Error with Delta=300 60121698
DPS(e)
Sample Data Faelik Damage Per Second (Effective)
Count 9999
Mean 432101.92
Minimum 371979.97
Maximum 517343.54
Spread ( max - min ) 145363.57
Range [ ( max - min ) / 2 * 100% ] 16.82%
Damage
Sample Data Faelik Damage
Count 9999
Mean 169403787.76
Minimum 128927198.61
Maximum 207784840.29
Spread ( max - min ) 78857641.67
Range [ ( max - min ) / 2 * 100% ] 23.28%
DTPS
Sample Data Faelik Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Faelik Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Faelik Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Faelik Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Faelik Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Faelik Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data FaelikTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Faelik Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 2.08 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 1.07 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 10.69 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
E 2.18 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
F 1.06 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
G 14.80 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
H 25.87 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
I 6.62 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
J 10.45 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
K 16.04 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
L 3.56 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
M 18.92 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
N 0.98 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
O 0.76 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
P 74.47 void_bolt
Q 6.78 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
R 2.05 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
S 47.87 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
T 4.82 shadow_word_death,if=cooldown.shadow_word_death.charges=2
U 2.34 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
V 0.01 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
W 0.29 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
X 14.09 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
Y 28.15 mind_sear,if=active_enemies>=3,interrupt=1
Z 33.20 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
a 29.32 shadow_word_pain

Sample Sequence

012456BCJGJBJJDQOSaMaaLMSWMXXMSUPYPSPYPSPYPSPZPaSPZJKKKGHHHHHIEDaSPYPSYPYSPZPaQMaaMSXMXHGIKICDSYPYSPZPSZPaaMaaMSHHHHIDSYPYSPYPSZPZPQaMSXLMXHGHHIDYPSYPaaPSYPZPSZPZPaaMSHHHHHIGDYPYPSaPZPSZPZPaaMaKGHHHHIDQPSYPZPSZPUZMaaMSXKHHGIDYPSYPYSPaZPSZPZaMaaGHHHKHIEEDQPSYPZLaPSZPZMaaMaSMXXMSXMaYPSYPYPSYPJGJKJGJDZPSZPZPaaPQPSTPZPSZPRRGJGJDZaPSZPTZPSZP7ZPSTPZPRSJGJKKFDQPSZPZLPSTP

Sample Sequence Table

time name target resources buffs
Pre flask Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.157 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity bloodlust, potion_of_deadly_grace
0:02.085 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity bloodlust, potion_of_deadly_grace
0:06.996 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity bloodlust, potion_of_deadly_grace
0:07.924 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity bloodlust, potion_of_deadly_grace
0:10.982 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity bloodlust, potion_of_deadly_grace
0:11.910 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity bloodlust, potion_of_deadly_grace
0:13.147 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity bloodlust, potion_of_deadly_grace
0:14.663 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity bloodlust, potion_of_deadly_grace
0:14.663 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:18.849 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, sphere_of_insanity, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace
0:19.732 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.8/100: 96% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:20.606 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:21.473 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 81.3/100: 81% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:22.333 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:23.189 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.8/100: 82% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(9), insanity_drain_stacks(6)
0:24.035 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity bloodlust, sphere_of_insanity, voidform(10), insanity_drain_stacks(7)
0:24.035 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7)
0:24.787 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8)
0:25.542 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8)
0:26.291 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 95.9/100: 96% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(9)
0:27.040 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10)
0:27.793 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11)
0:28.546 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 79.8/100: 80% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11)
0:29.295 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.3/100: 89% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(12)
0:30.046 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.4/100: 93% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13)
0:30.800 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.2/100: 82% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14)
0:31.552 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14)
0:32.490 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.4/100: 98% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), mind_sear_on_hit_reset
0:33.439 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mind_sear_on_hit_reset
0:34.540 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 90% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(17)
0:35.288 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18)
0:36.260 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), mind_sear_on_hit_reset
0:37.115 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), mind_sear_on_hit_reset
0:38.165 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21)
0:38.917 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22)
0:39.884 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), mind_sear_on_hit_reset
0:40.691 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), mind_sear_on_hit_reset
0:41.895 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.8/100: 79% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25)
0:42.648 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25)
0:44.215 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.3/100: 56% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(27)
0:45.138 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.5/100: 53% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28)
0:46.052 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.3/100: 35% insanity twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(29)
0:46.967 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.5/100: 29% insanity twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30)
0:47.872 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.5/100: 25% insanity twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31)
0:49.950 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity lingering_insanity(35)
0:51.016 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity raid_movement, lingering_insanity(35)
0:51.911 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/100: 5% insanity raid_movement, lingering_insanity(35)
0:52.803 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity raid_movement, lingering_insanity(35)
0:53.698 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity lingering_insanity(35)
0:54.591 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity lingering_insanity(35)
0:55.484 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity lingering_insanity(35)
0:56.379 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity lingering_insanity(35)
0:57.273 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity lingering_insanity(35)
0:58.167 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity lingering_insanity(35)
0:59.060 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity lingering_insanity(35)
1:00.190 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity raid_movement, lingering_insanity(35), mind_sear_on_hit_reset
1:01.083 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity raid_movement, lingering_insanity(35), mind_sear_on_hit_reset
1:01.083 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity raid_movement, sphere_of_insanity, voidform, lingering_insanity(35), insanity_drain_stacks, mind_sear_on_hit_reset
1:01.969 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity sphere_of_insanity, voidform, lingering_insanity(35), insanity_drain_stacks, mind_sear_on_hit_reset
1:02.854 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.2/100: 79% insanity sphere_of_insanity, voidform(2), lingering_insanity(35), insanity_drain_stacks(2)
1:03.723 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.9/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(35), insanity_drain_stacks(3)
1:05.428 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.2/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(35), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:06.277 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(35), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:07.119 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(35), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:08.357 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.2/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(35), insanity_drain_stacks(8), mind_sear_on_hit_reset
1:09.217 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.7/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:10.880 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
1:11.974 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
1:13.049 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.6/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
1:15.401 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
1:16.444 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.2/100: 76% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
1:17.480 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.8/100: 63% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
1:20.295 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 61.7/100: 62% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(18)
1:21.298 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.5/100: 60% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(19)
1:22.292 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.5/100: 45% insanity raid_movement, sphere_of_insanity, voidform(22), insanity_drain_stacks(20)
1:23.279 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 35.2/100: 35% insanity raid_movement, sphere_of_insanity, voidform(23), insanity_drain_stacks(21)
1:24.257 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.2/100: 36% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(22)
1:25.232 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity sphere_of_insanity, voidform(25), insanity_drain_stacks(23)
1:26.197 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(24)
1:27.153 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 10.9/100: 11% insanity sphere_of_insanity, voidform(27), insanity_drain_stacks(25)
1:28.102 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(27)
1:29.052 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(27)
1:30.002 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(27)
1:32.271 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity raid_movement, lingering_insanity(27), mind_sear_on_hit_reset
1:33.222 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity lingering_insanity(27), mind_sear_on_hit_reset
1:35.312 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, lingering_insanity(27), mind_sear_on_hit_reset
1:36.261 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, lingering_insanity(27), mind_sear_on_hit_reset
1:36.261 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(27), insanity_drain_stacks, mind_sear_on_hit_reset
1:37.201 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.9/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(27), insanity_drain_stacks, mind_sear_on_hit_reset
1:38.709 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.5/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(27), insanity_drain_stacks(3), mind_sear_on_hit_reset
1:39.629 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.5/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(27), insanity_drain_stacks(4), mind_sear_on_hit_reset
1:40.993 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.3/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(27), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:41.897 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(27), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:42.788 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.6/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(27), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:44.702 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.3/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
1:45.804 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
1:46.898 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
1:47.981 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.6/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
1:49.049 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.1/100: 66% insanity raid_movement, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
1:50.109 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.4/100: 57% insanity raid_movement, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
1:51.159 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 43.7/100: 44% insanity raid_movement, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
1:52.199 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity raid_movement, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
1:53.228 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.1/100: 28% insanity raid_movement, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
1:54.250 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 14.1/100: 14% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
1:55.262 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.2/100: 11% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
1:56.265 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(20)
1:57.272 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(20)
1:58.276 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(20)
1:59.280 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(20)
2:00.284 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(20)
2:02.618 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(20), mind_sear_on_hit_reset, burning_intensity(2)
2:02.618 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity sphere_of_insanity, voidform, lingering_insanity(20), insanity_drain_stacks, mind_sear_on_hit_reset, burning_intensity(2)
2:03.614 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity sphere_of_insanity, voidform, lingering_insanity(20), insanity_drain_stacks, mind_sear_on_hit_reset, burning_intensity(3)
2:04.801 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.4/100: 68% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(20), insanity_drain_stacks(3), mind_sear_on_hit_reset, burning_intensity(4)
2:05.775 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.4/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(20), insanity_drain_stacks(4), mind_sear_on_hit_reset, burning_intensity(5)
2:07.292 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(20), insanity_drain_stacks(5), mind_sear_on_hit_reset, burning_intensity(7)
2:08.435 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.1/100: 80% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(20), insanity_drain_stacks(6), mind_sear_on_hit_reset, burning_intensity(8)
2:09.374 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(20), insanity_drain_stacks(7), mind_sear_on_hit_reset, burning_intensity(9)
2:11.340 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.2/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset, burning_intensity(11)
2:12.435 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset, burning_intensity(12)
2:13.531 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.6/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset, burning_intensity(13)
2:14.615 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.9/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), burning_intensity(14)
2:15.681 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.4/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), burning_intensity(15)
2:18.085 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), burning_intensity(17)
2:19.119 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.6/100: 52% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), burning_intensity(18)
2:20.459 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.9/100: 44% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(17), burning_intensity(20)
2:21.471 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 29.1/100: 29% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(18)
2:22.477 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.2/100: 27% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(19)
2:23.481 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 21.2/100: 21% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(20)
2:24.478 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.3/100: 6% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(21)
2:24.478 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 6.3/100: 6% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(21)
2:25.262 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 12.1/100: 12% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(22)
2:26.046 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 5.0/100: 5% insanity power_infusion, lingering_insanity(24)
2:26.824 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity power_infusion, lingering_insanity(24)
2:27.602 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity power_infusion, lingering_insanity(24)
2:28.381 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity power_infusion, lingering_insanity(24)
2:29.161 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity power_infusion, lingering_insanity(24)
2:30.983 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity power_infusion, lingering_insanity(24), mind_sear_on_hit_reset
2:30.983 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity power_infusion, sphere_of_insanity, voidform, lingering_insanity(24), insanity_drain_stacks, mind_sear_on_hit_reset
2:32.290 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.5/100: 100% insanity power_infusion, sphere_of_insanity, voidform(2), lingering_insanity(24), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:33.271 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity power_infusion, sphere_of_insanity, voidform(3), lingering_insanity(24), insanity_drain_stacks(3), mind_sear_on_hit_reset
2:34.028 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(24), insanity_drain_stacks(4), mind_sear_on_hit_reset
2:35.299 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(24), insanity_drain_stacks(5), mind_sear_on_hit_reset
2:36.054 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(24), insanity_drain_stacks(6), mind_sear_on_hit_reset
2:36.808 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(24), insanity_drain_stacks(6), mind_sear_on_hit_reset
2:37.557 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.2/100: 87% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(24), insanity_drain_stacks(7), mind_sear_on_hit_reset
2:38.309 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(24), insanity_drain_stacks(8), mind_sear_on_hit_reset
2:39.080 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.3/100: 99% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
2:40.519 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.8/100: 96% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
2:41.394 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.8/100: 93% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
2:43.464 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
2:44.316 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.9/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
2:45.330 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
2:46.378 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
2:47.414 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.5/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
2:49.871 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
2:50.874 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
2:51.870 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.1/100: 24% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
2:52.859 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 8.1/100: 8% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(22)
2:53.841 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.2/100: 8% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(23)
2:54.819 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(24)
2:55.791 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(24)
2:56.764 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(24)
2:57.736 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(24)
2:58.710 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(24)
2:59.683 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(24)
3:01.167 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity lingering_insanity(24), mind_sear_on_hit_reset
3:02.140 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity lingering_insanity(24), mind_sear_on_hit_reset
3:02.140 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity sphere_of_insanity, voidform, lingering_insanity(24), insanity_drain_stacks, mind_sear_on_hit_reset
3:04.048 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(24), insanity_drain_stacks(2), mind_sear_on_hit_reset
3:04.992 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.4/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(24), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:06.845 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.4/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(24), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:07.766 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(24), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:08.677 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(24), insanity_drain_stacks(7), mind_sear_on_hit_reset
3:09.583 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.9/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(24), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:10.562 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.4/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
3:12.935 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.1/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
3:14.012 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.6/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
3:15.089 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
3:16.157 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.4/100: 60% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
3:17.204 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.7/100: 60% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
3:19.473 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.3/100: 34% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
3:20.492 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.1/100: 32% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
3:21.501 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.1/100: 17% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
3:22.501 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 1.7/100: 2% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
3:23.497 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.7/100: 3% insanity raid_movement, sphere_of_insanity, voidform(22), insanity_drain_stacks(22)
3:24.486 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(22)
3:25.478 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity lingering_insanity(22)
3:26.466 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity lingering_insanity(22)
3:27.453 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity lingering_insanity(22)
3:28.441 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity lingering_insanity(22)
3:29.429 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity lingering_insanity(22)
3:30.418 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity lingering_insanity(22)
3:32.692 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity lingering_insanity(22), mind_sear_on_hit_reset
3:32.692 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity sphere_of_insanity, voidform, lingering_insanity(22), insanity_drain_stacks, mind_sear_on_hit_reset
3:37.025 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(22), insanity_drain_stacks(2)
3:37.962 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.1/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(22), insanity_drain_stacks(3)
3:38.893 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.6/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(4)
3:40.243 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.1/100: 95% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(22), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:41.255 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:43.770 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.3/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(9)
3:44.846 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(10)
3:45.913 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.1/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(11)
3:46.969 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.4/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(12)
3:48.016 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(13)
3:49.051 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.6/100: 62% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(14)
3:50.232 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 45.8/100: 46% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(15)
3:51.249 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(16)
3:52.257 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.4/100: 31% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(17)
3:53.256 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 17.4/100: 17% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(18)
3:54.248 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.8/100: 20% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(19)
3:55.237 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 14.7/100: 15% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(20)
3:56.214 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(24)
3:57.187 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity lingering_insanity(24)
3:58.158 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 11.0/100: 11% insanity lingering_insanity(24)
3:59.129 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity lingering_insanity(24)
4:00.100 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity lingering_insanity(24)
4:02.879 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity lingering_insanity(24), mind_sear_on_hit_reset
4:02.879 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity sphere_of_insanity, voidform, lingering_insanity(24), insanity_drain_stacks, mind_sear_on_hit_reset
4:04.787 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(24), insanity_drain_stacks(2), mind_sear_on_hit_reset
4:05.732 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(24), insanity_drain_stacks(3), mind_sear_on_hit_reset
4:06.791 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.5/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(24), insanity_drain_stacks(4), mind_sear_on_hit_reset
4:08.288 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(24), insanity_drain_stacks(6), mind_sear_on_hit_reset
4:09.202 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(24), insanity_drain_stacks(7), mind_sear_on_hit_reset
4:10.646 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(24), insanity_drain_stacks(8), mind_sear_on_hit_reset
4:11.699 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
4:12.795 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
4:13.879 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
4:14.957 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.5/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
4:16.020 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
4:17.076 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.8/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
4:18.126 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
4:19.162 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.9/100: 57% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
4:20.323 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.4/100: 43% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
4:21.343 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
4:22.352 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
4:23.353 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.5/100: 11% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
4:24.347 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(22)
4:25.337 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(22)
4:26.326 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, lingering_insanity(22)
4:27.315 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity twist_of_fate, lingering_insanity(22)
4:28.303 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity raid_movement, twist_of_fate, lingering_insanity(22)
4:29.292 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity twist_of_fate, lingering_insanity(22)
4:30.281 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity twist_of_fate, lingering_insanity(22)
4:31.779 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, lingering_insanity(22), mind_sear_on_hit_reset
4:32.767 shadow_word_pain Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, lingering_insanity(22), mind_sear_on_hit_reset
4:33.755 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, lingering_insanity(22), mind_sear_on_hit_reset
4:33.755 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(22), insanity_drain_stacks, mind_sear_on_hit_reset
4:38.023 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(22), insanity_drain_stacks(2)
4:38.962 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.5/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(22), insanity_drain_stacks(3)
4:39.893 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(4)
4:41.439 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(22), insanity_drain_stacks(5), mind_sear_on_hit_reset
4:42.476 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(6), mind_sear_on_hit_reset
4:44.284 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(8)
4:44.284 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(8)
4:45.147 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.5/100: 75% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(9)
4:46.004 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(10)
4:46.860 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(11)
4:47.707 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(11)
4:48.547 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.8/100: 89% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(12)
4:50.151 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 72.5/100: 72% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(14)
4:51.019 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.7/100: 84% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(15)
4:51.836 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.7/100: 75% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(16)
4:52.649 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 65.6/100: 66% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(16)
4:53.454 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.1/100: 72% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(17)
4:54.254 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18)
4:55.055 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 62.5/100: 62% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19)
4:55.844 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20)
4:56.630 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 64.6/100: 65% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20)
4:57.416 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 59.5/100: 59% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21)
4:58.190 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.2/100: 65% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22)
4:58.962 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 74.7/100: 75% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23)
4:59.730 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 64.7/100: 65% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23)
5:00.491 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.7/100: 70% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(24)
5:01.248 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25)
5:02.484 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.5/100: 76% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mind_sear_on_hit_reset
5:03.236 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.3/100: 79% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mind_sear_on_hit_reset
5:03.988 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.8/100: 83% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mind_sear_on_hit_reset
5:05.175 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mind_sear_on_hit_reset
5:06.086 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.2/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mind_sear_on_hit_reset
5:07.653 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.7/100: 55% insanity twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mind_sear_on_hit_reset
5:08.769 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset
5:09.658 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.5/100: 36% insanity twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset
5:11.087 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.1/100: 4% insanity twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(35), mind_sear_on_hit_reset
5:11.959 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(39), mind_sear_on_hit_reset
5:13.484 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity twist_of_fate, lingering_insanity(39), mind_sear_on_hit_reset
5:14.352 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity twist_of_fate, lingering_insanity(39), mind_sear_on_hit_reset
5:16.665 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity raid_movement, twist_of_fate, lingering_insanity(39)
5:17.535 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity twist_of_fate, lingering_insanity(39)
5:20.409 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity twist_of_fate, lingering_insanity(39)
5:21.277 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity twist_of_fate, lingering_insanity(39)
5:24.062 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity twist_of_fate, lingering_insanity(39)
5:24.062 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(39), insanity_drain_stacks
5:26.052 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.4/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(39), insanity_drain_stacks(2)
5:26.896 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(39), insanity_drain_stacks(3)
5:27.738 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(39), insanity_drain_stacks(4)
5:28.571 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.4/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(39), insanity_drain_stacks(5)
5:29.394 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.6/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(39), insanity_drain_stacks(6)
5:31.211 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.7/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(39), insanity_drain_stacks(8)
5:32.016 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 83% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(39), insanity_drain_stacks(8)
5:33.106 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.8/100: 77% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
5:34.200 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.3/100: 65% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
5:35.283 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.9/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
5:39.574 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.7/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(12)
5:40.608 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.2/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(13)
5:41.638 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.4/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
5:42.654 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.8/100: 62% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(15)
5:43.662 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.8/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
5:45.813 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.8/100: 37% insanity twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), burning_intensity(2)
5:46.794 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.9/100: 36% insanity twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(19), burning_intensity(3)
5:47.776 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.9/100: 34% insanity twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(20), burning_intensity(4)
5:48.979 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.4/100: 11% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(21), burning_intensity(5)
5:49.935 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.4/100: 9% insanity twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(22), burning_intensity(6)
5:50.887 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.5/100: 0% insanity twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(23), burning_intensity(7)
5:51.829 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(28), burning_intensity(8)
5:52.770 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(28), burning_intensity(9)
5:59.170 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity twist_of_fate, lingering_insanity(28), burning_intensity(15)
6:00.113 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, lingering_insanity(28), burning_intensity(16)
6:03.209 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, lingering_insanity(28), burning_intensity(19)
6:03.209 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(28), insanity_drain_stacks, burning_intensity(19)
6:04.362 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.6/100: 66% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(28), insanity_drain_stacks(2), burning_intensity(20)
6:05.285 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.4/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(28), insanity_drain_stacks(3)
6:06.200 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(28), insanity_drain_stacks(3)
6:07.115 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(28), insanity_drain_stacks(4)
6:08.023 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.1/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(28), insanity_drain_stacks(5)
6:08.914 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.2/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(28), insanity_drain_stacks(6)
6:09.797 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.3/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(28), insanity_drain_stacks(7)
6:10.677 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.5/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(28), insanity_drain_stacks(8)
6:11.643 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.6/100: 80% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
6:12.750 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
6:13.844 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.3/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
6:14.923 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
6:14.923 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace
6:17.323 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), potion_of_deadly_grace
6:18.370 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.2/100: 46% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), potion_of_deadly_grace
6:19.410 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.2/100: 45% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), potion_of_deadly_grace
6:20.438 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.2/100: 38% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace
6:21.455 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.9/100: 41% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), potion_of_deadly_grace
6:23.709 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), potion_of_deadly_grace
6:24.701 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.0/100: 13% insanity twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), potion_of_deadly_grace
6:25.688 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.5/100: 3% insanity twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(23), potion_of_deadly_grace
6:26.668 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(23), potion_of_deadly_grace
6:33.793 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity twist_of_fate, lingering_insanity(23), potion_of_deadly_grace
6:34.772 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity twist_of_fate, lingering_insanity(23), potion_of_deadly_grace
6:36.129 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity raid_movement, twist_of_fate, lingering_insanity(23), potion_of_deadly_grace
6:37.109 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity raid_movement, twist_of_fate, lingering_insanity(23), potion_of_deadly_grace
6:38.092 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity twist_of_fate, lingering_insanity(23), potion_of_deadly_grace
6:39.073 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity twist_of_fate, lingering_insanity(23), potion_of_deadly_grace
6:39.073 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(23), insanity_drain_stacks, potion_of_deadly_grace
6:43.301 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.7/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(23), insanity_drain_stacks(2)
6:44.235 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(23), insanity_drain_stacks(3)
6:45.160 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(23), insanity_drain_stacks(4)
6:46.075 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.4/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(23), insanity_drain_stacks(5)
6:46.984 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.1/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(23), insanity_drain_stacks(5), burning_intensity
6:48.992 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.2/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), burning_intensity(3)
6:48.992 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.2/100: 79% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), burning_intensity(3)
6:49.988 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.2/100: 87% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(8), burning_intensity(4)
6:50.856 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.2/100: 96% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(9), burning_intensity(5)
6:51.711 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(10), burning_intensity(6)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6253 5928 0
Agility 7827 7502 0
Stamina 33652 33652 20880
Intellect 33412 31706 22871 (765)
Spirit 5 5 0
Health 2019120 2019120 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 33412 31706 0
Crit 25.52% 25.52% 7183
Haste 24.90% 23.74% 7717
Damage / Heal Versatility 0.73% 0.73% 290
ManaReg per Second 8800 8800 0
Mastery 43.18% 43.18% 3243
Armor 1628 1628 1628
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 858.00
Local Head Night Dreamer Crest
ilevel: 850, stats: { 211 Armor, +1297 Int, +1945 Sta, +904 Haste, +400 Mastery }
Local Neck Chain of the Underking
ilevel: 870, stats: { +1319 Sta, +1188 Crit, +791 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Shoulderpads of Crashing Waves
ilevel: 855, stats: { 199 Armor, +1019 Int, +1529 Sta, +627 Mastery, +370 Crit }
Local Chest Fluxflow Robes
ilevel: 850, stats: { 260 Armor, +1297 Int, +1945 Sta, +876 Haste, +428 Crit, +559 Avoidance }
Local Waist Roggthread Cord
ilevel: 860, stats: { 152 Armor, +1068 Int, +1601 Sta, +726 Haste, +290 Vers }
Local Legs Ragged Horrorweave Leggings
ilevel: 850, stats: { 228 Armor, +1945 Sta, +1297 Int, +736 Haste, +568 Mastery }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 850, stats: { 179 Armor, +1459 Sta, +973 Int, +658 Haste, +322 Crit }
Local Wrists Sunfrost Wristwraps
ilevel: 840, stats: { 110 Armor, +665 Int, +997 Sta, +490 Haste, +217 Crit, +379 unknown }
Local Hands Ink-Smudged Handwraps
ilevel: 840, stats: { 157 Armor, +886 Int, +1329 Sta, +552 Mastery, +391 Haste }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +150 Haste }
Local Finger2 Sephuz's Secret
ilevel: 895, stats: { +1665 Sta, +620 Haste, +1552 Crit }, gems: { +150 Haste }, enchant: { +150 Haste }
Local Trinket1 Nightborne Researcher's Phial
ilevel: 835, stats: { +1073 Int, +882 Crit }, gems: { +200 Int }
Local Trinket2 Infernal Writ
ilevel: 840, stats: { +1123 Int }
Local Back Evergreen Vinewrap Drape
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +502 Haste, +245 Crit }, gems: { +150 Haste }, enchant: { +150 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 880, weapon: { 1508 - 2803, 1.8 }, stats: { +735 Int, +1103 Sta, +318 Crit, +305 Mastery, +9358 Int }, relics: { +45 ilevels, +43 ilevels, +42 ilevels }
Local Off Hand Secrets of the Void
ilevel: 880, stats: { +965 Int, +1448 Sta, +569 Haste, +252 Crit }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Faelik"
origin="https://us.api.battle.net/wow/character/thrall/Faelik/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/187/153787323-avatar.jpg"
level=110
race=undead
role=spell
position=back
professions=alchemy=575/herbalism=800
talents=1211211
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:769:1:770:1:771:3:772:3:773:3:775:3:776:3:777:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=night_dreamer_crest,id=139086,bonus_id=3432/1512/3337
neck=chain_of_the_underking,id=134495,bonus_id=3414/1522/3337,enchant=mark_of_the_hidden_satyr
shoulders=shoulderpads_of_crashing_waves,id=137360,bonus_id=3411/1507/3336
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1808/1477/3336,gems=150haste,enchant=150int
chest=fluxflow_robes,id=134413,bonus_id=3410/40/1502/3336
tabard=renowned_guild_tabard,id=69210
wrists=sunfrost_wristwraps,id=139130,bonus_id=1727/43/1502/1813
hands=inksmudged_handwraps,id=134421,bonus_id=1727/1492/1813
waist=roggthread_cord,id=134171,bonus_id=3410/1522/3337
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1807/1472
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1807/1472
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1805/1502/3337,enchant=150haste
finger2=sephuzs_secret,id=132452,bonus_id=1811,gems=150haste,enchant=150haste
trinket1=nightborne_researchers_phial,id=134292,bonus_id=3432/1808/603/1497/1674,gems=200int
trinket2=infernal_writ,id=137485,bonus_id=1727/1492/1813
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=141273/139254/137347/0,relic_id=3474:1517:3336/1807:1472/3411:1497:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=858.13
# gear_stamina=20880
# gear_intellect=22871
# gear_crit_rating=7183
# gear_haste_rating=7717
# gear_mastery_rating=3243
# gear_versatility_rating=290
# gear_avoidance_rating=559
# gear_armor=1628

Raji

Raji : 359588 dps, 248687 dps to main target

  • Race: Troll
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
359588.4 359588.4 305.2 / 0.085% 59881.3 / 16.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.66% 48.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Raji/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • tailoring: 756
  • enchanting: 715
Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 10.77 9.33 9.03 8.62 7.81
Normalized 1.00 0.87 0.84 0.80 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.38 0.38
Gear Ranking
Optimizers
Ranking
  • Int > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.77, CritRating=9.03, HasteRating=9.33, MasteryRating=7.81, Versatility=8.62 )

Scale Factors for other metrics

Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 10.77 9.33 9.03 8.62 7.81
Normalized 1.00 0.87 0.84 0.80 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.38 0.38
Gear Ranking
Optimizers
Ranking
  • Int > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.77, CritRating=9.03, HasteRating=9.33, MasteryRating=7.81, Versatility=8.62 )
Scale Factors for Raji Priority Target Damage Per Second
Int Crit Haste Vers Mastery
Scale Factors 7.77 7.25 6.97 5.98 5.54
Normalized 1.00 0.93 0.90 0.77 0.71
Scale Deltas 1138 1138 1138 1138 1138
Error 0.13 0.13 0.13 0.13 0.13
Gear Ranking
Optimizers
Ranking
  • Int > Crit > Haste > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=7.77, CritRating=7.25, HasteRating=6.97, MasteryRating=5.54, Versatility=5.98 )
Scale Factors for Raji Damage Per Second (Effective)
Int Haste Crit Vers Mastery
Scale Factors 10.77 9.33 9.03 8.62 7.81
Normalized 1.00 0.87 0.84 0.80 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.77, CritRating=9.03, HasteRating=9.33, MasteryRating=7.81, Versatility=8.62 )
Scale Factors for Raji Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for RajiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Raji 359588
Deadly Grace 9451 2.6% 28.7 14.43sec 130173 0 Direct 28.7 98068 196245 130288 32.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.69 28.67 0.00 0.00 0.0000 0.0000 3734958.64 3734958.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.26 67.18% 98067.58 89490 107388 98059.15 91876 103978 1888703 1888703 0.00
crit 9.41 32.82% 196245.24 178979 214775 196245.22 178979 214775 1846256 1846256 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 22697 6.3% 48.4 8.20sec 187760 170113 Direct 49.4 138570 277151 183964 32.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.44 49.44 0.00 0.00 1.1037 0.0000 9094559.85 9094559.85 0.00 170112.60 170112.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.24 67.25% 138570.36 102724 160249 138585.39 128040 148476 4606687 4606687 0.00
crit 16.19 32.75% 277151.40 205448 320499 277184.58 225993 320499 4487873 4487873 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 13258 3.8% 47.8 8.44sec 113220 71870 Periodic 126.5 32253 64496 42799 32.7% 16.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.82 0.00 126.50 126.50 1.5754 0.5171 5414104.18 5414104.18 0.00 71869.91 71869.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.1 67.29% 32252.67 23481 36631 32188.83 29671 34365 2745333 2745333 0.00
crit 41.4 32.71% 64496.06 46962 73261 64364.33 55311 70522 2668771 2668771 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mind Sear 38967 10.7% 28.0 10.22sec 550482 312444 Periodic 404.4 28747 57509 38149 32.7% 10.4%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.03 0.00 70.93 404.42 1.7619 0.5893 15427863.23 15427863.23 0.00 312444.07 312444.07
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 272.2 67.31% 28746.70 22092 34464 28768.93 26992 31269 7825448 7825448 0.00
crit 132.2 32.69% 57508.82 44185 68928 57551.34 52622 62634 7602415 7602415 0.00
 
 

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing Shadow damage to all targets within $49821a2 yards.
  • description:Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a2 yards.
  • description:{$@spelldesc48045=Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Death 8560 2.4% 14.2 10.17sec 240900 225407 Direct 14.2 181474 363030 240913 32.7%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.18 14.18 0.00 0.00 1.0688 0.0000 3416500.62 3416500.62 0.00 225407.44 225407.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.54 67.27% 181474.10 119090 185780 181528.92 158389 185780 1731301 1731301 0.00
crit 4.64 32.73% 363029.81 238180 371560 361935.82 0 371560 1685200 1685200 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 43773 12.2% 41.5 9.39sec 421868 415186 Direct 41.5 33914 67841 44999 32.7%  
Periodic 296.7 39724 79438 52712 32.7% 103.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.50 41.50 296.73 296.73 1.0161 1.3931 17508374.10 17508374.10 0.00 38434.58 415185.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.94 67.33% 33914.06 26348 41103 33925.58 30733 37800 947664 947664 0.00
crit 13.56 32.67% 67841.49 52697 82207 67866.94 57439 78782 919858 919858 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.7 67.30% 39724.12 140 45113 39731.77 38578 40743 7932497 7932497 0.00
crit 97.0 32.70% 79437.92 57 90227 79439.72 75008 83354 7708355 7708355 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Shadowy Apparitions 14728 4.1% 167.4 2.36sec 35158 0 Direct 165.9 26725 53460 35466 32.7%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 167.37 165.92 0.00 0.00 0.0000 0.0000 5884551.34 5884551.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.67 67.30% 26724.82 19566 30524 26728.59 25331 28107 2984325 2984325 0.00
crit 54.25 32.70% 53459.93 39133 61047 53468.17 49545 57953 2900226 2900226 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 79862 22.2% 33.7 9.07sec 943267 881830 Periodic 358.2 66954 133953 88864 32.7% 187.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.75 0.00 358.24 358.24 1.0697 2.0960 31834961.55 31834961.55 0.00 40452.01 881830.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 241.1 67.30% 66953.94 28 77183 66971.81 64354 69418 16141899 16141899 0.00
crit 117.2 32.70% 133952.95 137 154366 133984.72 126315 140938 15693063 15693063 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 49681 13.9% 81.4 4.79sec 244385 231077 Direct 81.1 184736 369534 245180 32.7%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.39 81.13 0.00 0.00 1.0576 0.0000 19891589.42 19891589.42 0.00 231077.22 231077.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.59 67.29% 184736.09 125253 195395 184725.46 178389 190214 10085561 10085561 0.00
crit 26.54 32.71% 369533.58 250506 390790 369504.14 345699 390790 9806029 9806029 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 9974 2.8% 11.5 35.45sec 346670 0 Direct 50.3 59809 119668 79349 32.6%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.51 50.29 0.00 0.00 0.0000 0.0000 3990807.86 3990807.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.88 67.36% 59808.95 53364 64037 59812.38 54254 64037 2026074 2026074 0.00
crit 16.42 32.64% 119667.55 106728 128074 119669.55 106728 128074 1964734 1964734 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 15284 4.3% 6.9 61.24sec 884253 239298 Periodic 42.5 108573 216904 144106 32.8% 5.9%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 0.00 42.48 42.48 3.6952 0.5547 6122204.73 6122204.73 0.00 239298.18 239298.18
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.5 67.20% 108573.27 623 122096 108562.00 93326 120330 3099618 3099618 0.00
crit 13.9 32.80% 216904.11 1246 244193 216885.70 116493 244193 3022586 3022586 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Volatile Ichor 31779 8.8% 22.0 17.94sec 571265 0 Direct 74.5 127311 254705 168904 32.6%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.03 74.52 0.00 0.00 0.0000 0.0000 12587371.09 12587371.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.19 67.35% 127311.17 117119 140543 127400.35 117719 139910 6389976 6389976 0.00
crit 24.33 32.65% 254704.93 234238 281085 254897.35 234238 281085 6197395 6197395 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=65033} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:103616.84
  • base_dd_max:103616.84
 
pet - mindbender 61667 / 16198
melee 61667 4.5% 91.1 4.27sec 71134 64372 Direct 91.1 53608 107213 71134 32.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.10 91.10 0.00 0.00 1.1050 0.0000 6480026.52 6480026.52 0.00 64372.19 64372.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.31 67.30% 53607.61 47561 54695 53607.28 52802 54546 3286744 3286744 0.00
crit 29.78 32.70% 107212.94 95121 109390 107210.05 103275 109390 3193283 3193283 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 30135 / 4793
Mind Flay (_void_tendril) 30135 (32737) 1.4% (2.1%) 9.2 40.53sec 327760 65199 Periodic 46.2 31708 63416 42061 32.6% 11.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.18 0.00 46.17 46.17 5.0271 1.0000 1941810.30 1941810.30 0.00 65199.36 65199.36
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.1 67.35% 31708.14 31708 31708 31708.14 31708 31708 985924 985924 0.00
crit 15.1 32.65% 63416.28 63416 63416 63397.25 0 63416 955887 955887 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 30659 0.3% 2.0 63.80sec 209008 42077 Periodic 9.9 31708 63416 42079 32.7% 2.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 9.87 9.87 4.9674 1.0000 415428.16 415428.16 0.00 42077.20 42077.20
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.6 67.30% 31708.14 31708 31708 31491.36 0 31708 210696 210696 0.00
crit 3.2 32.70% 63416.28 63416 63416 59256.49 0 63416 204732 204732 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 32635 0.2% 1.4 24.93sec 236505 42010 Periodic 7.6 31708 63416 42006 32.5% 1.9%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.35 0.00 7.61 7.61 5.6303 1.0000 319819.81 319819.81 0.00 42009.70 42009.70
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.1 67.52% 31708.14 31708 31708 31491.95 0 31708 163009 163009 0.00
crit 2.5 32.48% 63416.28 63416 63416 58227.67 0 63416 156811 156811 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 35878 0.2% 1.1 5.25sec 291319 43160 Periodic 7.7 31708 63416 43158 36.1% 1.9%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.14 0.00 7.71 7.71 6.7500 1.0000 332935.45 332935.45 0.00 43159.90 43159.90
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.9 63.89% 31708.14 31708 31708 31708.14 31708 31708 156276 156276 0.00
crit 2.8 36.11% 63416.28 63416 63416 58886.54 0 63416 176660 176660 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Raji
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Berserking 2.6 185.95sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Mindbender 7.1 60.46sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.12 0.00 0.00 0.00 1.1184 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - mindbender
Shadowcrawl 21.1 18.93sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.09 0.00 0.00 0.00 1.1241 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.6 0.0 186.0sec 186.0sec 6.31% 8.11% 0.0(0.0) 2.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 11.45% 0.0(0.0) 1.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 11.5 269.5 35.5sec 35.5sec 74.44% 74.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.66%
  • insanity_drain_stacks_2:2.94%
  • insanity_drain_stacks_3:2.86%
  • insanity_drain_stacks_4:3.05%
  • insanity_drain_stacks_5:3.42%
  • insanity_drain_stacks_6:3.32%
  • insanity_drain_stacks_7:3.08%
  • insanity_drain_stacks_8:3.38%
  • insanity_drain_stacks_9:3.47%
  • insanity_drain_stacks_10:3.11%
  • insanity_drain_stacks_11:2.95%
  • insanity_drain_stacks_12:3.04%
  • insanity_drain_stacks_13:3.03%
  • insanity_drain_stacks_14:3.05%
  • insanity_drain_stacks_15:2.88%
  • insanity_drain_stacks_16:2.85%
  • insanity_drain_stacks_17:2.76%
  • insanity_drain_stacks_18:2.71%
  • insanity_drain_stacks_19:2.65%
  • insanity_drain_stacks_20:2.41%
  • insanity_drain_stacks_21:2.10%
  • insanity_drain_stacks_22:1.86%
  • insanity_drain_stacks_23:1.61%
  • insanity_drain_stacks_24:1.36%
  • insanity_drain_stacks_25:1.22%
  • insanity_drain_stacks_26:1.07%
  • insanity_drain_stacks_27:0.89%
  • insanity_drain_stacks_28:0.81%
  • insanity_drain_stacks_29:0.74%
  • insanity_drain_stacks_30:0.61%
  • insanity_drain_stacks_31:0.55%
  • insanity_drain_stacks_32:0.45%
  • insanity_drain_stacks_33:0.33%
  • insanity_drain_stacks_34:0.16%
  • insanity_drain_stacks_35:0.06%
  • insanity_drain_stacks_36:0.02%
  • insanity_drain_stacks_37:0.01%
  • insanity_drain_stacks_38:0.00%
  • insanity_drain_stacks_39:0.00%
  • insanity_drain_stacks_40:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 11.5 0.0 33.9sec 33.9sec 23.51% 23.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_14:0.00%
  • lingering_insanity_15:0.00%
  • lingering_insanity_16:0.04%
  • lingering_insanity_17:0.23%
  • lingering_insanity_18:0.35%
  • lingering_insanity_19:1.41%
  • lingering_insanity_20:2.65%
  • lingering_insanity_21:1.48%
  • lingering_insanity_22:0.77%
  • lingering_insanity_23:0.38%
  • lingering_insanity_24:0.50%
  • lingering_insanity_25:0.80%
  • lingering_insanity_26:1.73%
  • lingering_insanity_27:1.64%
  • lingering_insanity_28:1.48%
  • lingering_insanity_29:1.39%
  • lingering_insanity_30:0.77%
  • lingering_insanity_31:0.53%
  • lingering_insanity_32:0.56%
  • lingering_insanity_33:0.61%
  • lingering_insanity_34:0.78%
  • lingering_insanity_35:0.92%
  • lingering_insanity_36:1.62%
  • lingering_insanity_37:1.55%
  • lingering_insanity_38:0.79%
  • lingering_insanity_39:0.33%
  • lingering_insanity_40:0.13%
  • lingering_insanity_41:0.05%
  • lingering_insanity_42:0.01%
  • lingering_insanity_43:0.01%
  • lingering_insanity_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
mind_sear_on_hit_reset 11.7 16.3 25.6sec 10.2sec 26.30% 26.30% 0.0(0.0) 11.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_mind_sear_on_hit_reset
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • mind_sear_on_hit_reset_1:26.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of Deadly Grace 2.0 0.0 363.5sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Twist of Fate 8.5 408.4 29.5sec 0.9sec 63.10% 63.10% 408.4(408.4) 7.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:63.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.9 0.0 61.3sec 61.3sec 6.04% 6.04% 0.0(0.0) 5.2

Buff details

  • buff initial source:Raji
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 11.5 0.0 35.5sec 35.5sec 74.44% 67.64% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.87%
  • voidform_2:2.86%
  • voidform_3:2.85%
  • voidform_4:2.85%
  • voidform_5:2.84%
  • voidform_6:2.83%
  • voidform_7:2.83%
  • voidform_8:2.82%
  • voidform_9:2.81%
  • voidform_10:2.81%
  • voidform_11:2.80%
  • voidform_12:2.79%
  • voidform_13:2.78%
  • voidform_14:2.78%
  • voidform_15:2.77%
  • voidform_16:2.76%
  • voidform_17:2.74%
  • voidform_18:2.70%
  • voidform_19:2.62%
  • voidform_20:2.38%
  • voidform_21:2.15%
  • voidform_22:2.03%
  • voidform_23:1.95%
  • voidform_24:1.89%
  • voidform_25:1.80%
  • voidform_26:1.58%
  • voidform_27:1.32%
  • voidform_28:1.10%
  • voidform_29:0.91%
  • voidform_30:0.77%
  • voidform_31:0.69%
  • voidform_32:0.63%
  • voidform_33:0.57%
  • voidform_34:0.51%
  • voidform_35:0.43%
  • voidform_36:0.33%
  • voidform_37:0.17%
  • voidform_38:0.08%
  • voidform_39:0.03%
  • voidform_40:0.01%
  • voidform_41:0.00%
  • voidform_42:0.00%
  • voidform_43:0.00%
  • voidform_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: raid_movement 0.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.00%

Trigger Attempt Success

  • trigger_pct:0.05%
mindbender: Shadowcrawl 21.1 0.0 18.9sec 18.9sec 86.69% 84.74% 0.0(0.0) 14.0

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
void_tendril: raid_movement 4.0 0.0 68.6sec 68.6sec 19.49% 19.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:19.49%

Trigger Attempt Success

  • trigger_pct:100.00%
void_tendril: raid_movement 0.7 0.0 131.9sec 131.9sec 16.79% 16.79% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:16.80%

Trigger Attempt Success

  • trigger_pct:57.11%
void_tendril: raid_movement 0.3 0.0 0.0sec 0.0sec 12.28% 12.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:12.51%

Trigger Attempt Success

  • trigger_pct:35.00%
void_tendril: raid_movement 0.1 0.0 0.0sec 0.0sec 5.10% 5.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.28%

Trigger Attempt Success

  • trigger_pct:14.29%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Raji
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Raji
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Raji
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Raji
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Raji
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 165.92 621.20 (1084.54%) 3.74 42.48 6.40%
Insanity Drained by Voidform Insanity 5963.60 -4386.04 (-7657.49%) -0.74 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 49.44 586.92 (1024.68%) 11.87 6.33 1.07%
Insanity Gained from Mind Flay Insanity 126.50 252.96 (441.64%) 2.00 0.03 0.01%
Insanity Gained from Mind Sear Insanity 404.41 590.49 (1030.93%) 1.46 16.13 2.66%
Insanity Gained from Mindbender Insanity 91.10 315.75 (551.27%) 3.47 48.63 13.35%
Insanity Gained from Shadow Word: Death Insanity 14.18 377.25 (658.62%) 26.60 48.23 11.34%
Insanity Gained from Shadow Word: Pain Casts Insanity 41.50 123.67 (215.91%) 2.98 0.84 0.67%
Insanity Gained from Vampiric Touch Casts Insanity 33.75 134.70 (235.17%) 3.99 0.30 0.22%
Insanity Gained from Void Bolt Insanity 81.39 1129.98 (1972.81%) 13.88 172.33 13.23%
Insanity Saved by Void Torrent Insanity 483.18 310.39 (541.91%) 0.64 0.00 0.00%
Health from Vampiric Touch Ticks Health 358.24 0.00 (0.00%) 0.00 15917406.88 100.00%
mp5_regen Mana 662.57 0.00 (0.00%) 0.00 3522356.70 100.00%
Resource RPS-Gain RPS-Loss
Insanity 11.08 10.94
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 57.29 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 167.4 2.4sec
Void Eruption casted when a target with both DoTs was up 12.4 35.5sec
Void Eruption casted when a target with no DoTs was up 13.9 56.2sec
Void Eruption casted when a target with only Shadow Word: Pain was up 0.5 206.5sec
Void Eruption casted when a target with only Vampiric Touch was up 25.6 32.8sec
Void Tendril spawned from Call to the Void 7.3 52.8sec

Statistics & Data Analysis

Fight Length
Sample Data Raji Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Raji Damage Per Second
Count 9999
Mean 359588.35
Minimum 318242.10
Maximum 420168.10
Spread ( max - min ) 101926.01
Range [ ( max - min ) / 2 * 100% ] 14.17%
Standard Deviation 15572.4390
5th Percentile 336872.33
95th Percentile 388230.83
( 95th Percentile - 5th Percentile ) 51358.50
Mean Distribution
Standard Deviation 155.7322
95.00% Confidence Intervall ( 359283.12 - 359893.58 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7204
0.1 Scale Factor Error with Delta=300 2070126
0.05 Scale Factor Error with Delta=300 8280507
0.01 Scale Factor Error with Delta=300 207012679
Priority Target DPS
Sample Data Raji Priority Target Damage Per Second
Count 9999
Mean 248686.76
Minimum 229344.10
Maximum 268388.69
Spread ( max - min ) 39044.59
Range [ ( max - min ) / 2 * 100% ] 7.85%
Standard Deviation 5284.5945
5th Percentile 239962.78
95th Percentile 257339.20
( 95th Percentile - 5th Percentile ) 17376.42
Mean Distribution
Standard Deviation 52.8486
95.00% Confidence Intervall ( 248583.18 - 248790.34 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1734
0.1 Scale Factor Error with Delta=300 238400
0.05 Scale Factor Error with Delta=300 953601
0.01 Scale Factor Error with Delta=300 23840041
DPS(e)
Sample Data Raji Damage Per Second (Effective)
Count 9999
Mean 359588.35
Minimum 318242.10
Maximum 420168.10
Spread ( max - min ) 101926.01
Range [ ( max - min ) / 2 * 100% ] 14.17%
Damage
Sample Data Raji Damage
Count 9999
Mean 134907846.62
Minimum 105659602.33
Maximum 165830868.22
Spread ( max - min ) 60171265.89
Range [ ( max - min ) / 2 * 100% ] 22.30%
DTPS
Sample Data Raji Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Raji Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Raji Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Raji Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Raji Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Raji Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RajiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Raji Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
B 4.54 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
C 2.01 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
D 1.26 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
E 11.51 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
F 1.40 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
G 1.25 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
H 12.38 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
I 19.26 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
J 8.19 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
K 7.84 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
L 9.67 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
M 2.81 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
N 2.58 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
O 21.73 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
P 1.97 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
Q 1.78 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
R 55.92 void_bolt
S 6.93 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
T 4.96 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
U 41.01 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
V 7.98 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
W 0.02 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
X 0.20 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
Y 15.56 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
Z 18.08 mind_sear,if=active_enemies>=3,interrupt=1
a 31.59 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
b 28.40 shadow_word_pain

Sample Sequence

012456BCDKHESRbURaNRUaRbbObbOUYOYYOUZRZURZRUZRZURabKHKLLLLHIIEYYOMUQZRSRUaRbaRUbObbHIIIIIJHLEZRZURaRUaRabObHIIIIIBHJEbZRSRUaRaOUYOYYOUYIJCHJEbZQaRUaRaObbOUIIIIIBHJEZObSRUaNRaObbObbOUYOYJHJEZQZbRUaRaRbbLHIILIIJBHEZRZSRUaRaRbbOUYOTYOTUJCEZUQaRUVRabObUOVYOUTRMZRTURZSRUTRaHKHKEaRVURaRUaRVaRbbRTURTaRUKBLHKEaRS7RNUVRaRUaRaRUVRaRUTRaHKGEU

Sample Sequence Table

time name target resources buffs
Pre flask Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.211 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity bloodlust, potion_of_deadly_grace
0:02.191 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity bloodlust, potion_of_deadly_grace
0:03.172 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, potion_of_deadly_grace
0:06.231 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity bloodlust, potion_of_deadly_grace
0:07.212 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace
0:07.212 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:11.400 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.2/100: 93% insanity bloodlust, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace
0:12.334 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.2/100: 96% insanity bloodlust, raid_movement, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:13.261 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.2/100: 94% insanity bloodlust, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:14.179 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:15.088 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.1/100: 94% insanity bloodlust, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:17.162 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity bloodlust, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:17.162 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity bloodlust, berserking, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:17.931 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, berserking, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace
0:18.699 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity bloodlust, berserking, voidform(12), insanity_drain_stacks(9), potion_of_deadly_grace
0:19.463 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.1/100: 85% insanity bloodlust, berserking, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace
0:20.217 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, berserking, raid_movement, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace
0:20.970 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity bloodlust, berserking, raid_movement, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace
0:21.720 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 75.2/100: 75% insanity bloodlust, berserking, raid_movement, voidform(15), insanity_drain_stacks(12), potion_of_deadly_grace
0:22.471 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.4/100: 80% insanity bloodlust, berserking, raid_movement, voidform(16), insanity_drain_stacks(13), potion_of_deadly_grace
0:23.223 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.1/100: 76% insanity bloodlust, berserking, raid_movement, voidform(17), insanity_drain_stacks(14)
0:23.978 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 67.9/100: 68% insanity bloodlust, berserking, voidform(17), insanity_drain_stacks(14)
0:24.727 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.1/100: 76% insanity bloodlust, berserking, voidform(18), insanity_drain_stacks(15)
0:25.479 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 76.1/100: 76% insanity bloodlust, berserking, voidform(19), insanity_drain_stacks(16)
0:26.233 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity bloodlust, berserking, voidform(20), insanity_drain_stacks(17)
0:26.988 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 71.3/100: 71% insanity bloodlust, berserking, voidform(20), insanity_drain_stacks(17)
0:27.824 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 64.9/100: 65% insanity bloodlust, voidform(21), insanity_drain_stacks(18)
0:28.633 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 50.8/100: 51% insanity bloodlust, raid_movement, voidform(22), insanity_drain_stacks(19)
0:29.436 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.4/100: 56% insanity bloodlust, voidform(23), insanity_drain_stacks(20)
0:30.235 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity bloodlust, voidform(24), insanity_drain_stacks(21)
0:31.577 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.3/100: 59% insanity bloodlust, voidform(25), insanity_drain_stacks(22), mind_sear_on_hit_reset
0:32.363 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.9/100: 60% insanity bloodlust, voidform(26), insanity_drain_stacks(23), mind_sear_on_hit_reset
0:33.533 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.9/100: 59% insanity bloodlust, twist_of_fate, voidform(27), insanity_drain_stacks(24), mind_sear_on_hit_reset
0:34.307 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.8/100: 64% insanity bloodlust, twist_of_fate, voidform(28), insanity_drain_stacks(25), mind_sear_on_hit_reset
0:35.073 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity bloodlust, twist_of_fate, voidform(28), insanity_drain_stacks(25), mind_sear_on_hit_reset
0:36.380 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.5/100: 62% insanity bloodlust, twist_of_fate, voidform(30), insanity_drain_stacks(27), mind_sear_on_hit_reset
0:37.338 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.6/100: 61% insanity bloodlust, twist_of_fate, voidform(31), insanity_drain_stacks(28), mind_sear_on_hit_reset
0:38.092 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.1/100: 56% insanity bloodlust, twist_of_fate, voidform(31), insanity_drain_stacks(28), mind_sear_on_hit_reset
0:39.199 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity bloodlust, twist_of_fate, voidform(32), insanity_drain_stacks(29), mind_sear_on_hit_reset
0:39.947 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.7/100: 52% insanity bloodlust, twist_of_fate, voidform(33), insanity_drain_stacks(30), mind_sear_on_hit_reset
0:41.213 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.7/100: 36% insanity twist_of_fate, voidform(35), insanity_drain_stacks(32), mind_sear_on_hit_reset
0:42.157 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.1/100: 30% insanity twist_of_fate, voidform(35), insanity_drain_stacks(32), mind_sear_on_hit_reset
0:43.095 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.4/100: 26% insanity twist_of_fate, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset
0:44.268 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.3/100: 2% insanity raid_movement, twist_of_fate, voidform(38), insanity_drain_stacks(35), mind_sear_on_hit_reset
0:45.196 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(38)
0:46.753 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity twist_of_fate, lingering_insanity(38)
0:47.678 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity twist_of_fate, lingering_insanity(38)
0:50.353 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity raid_movement, lingering_insanity(38)
0:51.280 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity raid_movement, lingering_insanity(38)
0:52.205 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity raid_movement, lingering_insanity(38)
0:53.130 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity raid_movement, lingering_insanity(38)
0:54.056 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(38)
0:54.982 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(38)
0:55.908 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity lingering_insanity(38)
0:56.834 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(38)
0:56.834 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity voidform, insanity_drain_stacks
0:58.096 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 68.7/100: 69% insanity voidform(2), insanity_drain_stacks(2)
0:59.346 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity voidform(3), insanity_drain_stacks(3)
1:00.577 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.9/100: 69% insanity raid_movement, voidform(4), insanity_drain_stacks(4)
1:01.794 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.4/100: 59% insanity voidform(5), insanity_drain_stacks(5)
1:03.009 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity voidform(7), insanity_drain_stacks(7)
1:04.196 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.7/100: 72% insanity voidform(8), insanity_drain_stacks(8)
1:06.524 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
1:07.676 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.5/100: 93% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
1:11.859 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.2/100: 97% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
1:12.957 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity twist_of_fate, voidform(17), insanity_drain_stacks(13)
1:14.048 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.9/100: 92% insanity twist_of_fate, voidform(18), insanity_drain_stacks(14)
1:15.130 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity twist_of_fate, voidform(19), insanity_drain_stacks(15)
1:16.198 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity raid_movement, voidform(20), insanity_drain_stacks(16)
1:17.256 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.1/100: 72% insanity voidform(21), insanity_drain_stacks(17)
1:18.309 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.2/100: 58% insanity voidform(22), insanity_drain_stacks(18)
1:19.349 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.8/100: 56% insanity voidform(23), insanity_drain_stacks(19)
1:20.381 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.8/100: 42% insanity raid_movement, voidform(24), insanity_drain_stacks(20)
1:21.406 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 29.3/100: 29% insanity raid_movement, voidform(25), insanity_drain_stacks(21)
1:22.421 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.3/100: 26% insanity raid_movement, voidform(26), insanity_drain_stacks(22)
1:23.427 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.7/100: 10% insanity raid_movement, voidform(27), insanity_drain_stacks(23)
1:24.426 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(28)
1:25.420 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(28)
1:26.418 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(28)
1:27.414 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(28)
1:28.412 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(28)
1:29.409 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(28)
1:30.404 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(28)
1:31.998 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity lingering_insanity(28), mind_sear_on_hit_reset
1:32.995 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity raid_movement, lingering_insanity(28), mind_sear_on_hit_reset
1:33.994 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(28), mind_sear_on_hit_reset
1:33.994 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity voidform, insanity_drain_stacks, mind_sear_on_hit_reset
1:36.490 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.4/100: 77% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
1:37.721 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
1:39.601 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:40.805 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.3/100: 88% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:41.988 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.8/100: 93% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
1:44.672 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
1:45.812 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.9/100: 73% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
1:46.952 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.8/100: 68% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
1:48.275 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity raid_movement, twist_of_fate, voidform(15), insanity_drain_stacks(15)
1:49.381 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.4/100: 52% insanity voidform(16), insanity_drain_stacks(16)
1:50.742 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity raid_movement, voidform(17), insanity_drain_stacks(17)
1:51.825 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 16.3/100: 16% insanity raid_movement, voidform(18), insanity_drain_stacks(18)
1:52.899 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.7/100: 13% insanity raid_movement, voidform(19), insanity_drain_stacks(19)
1:53.963 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(20)
1:55.028 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(20)
1:56.092 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(20)
1:57.157 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(20)
1:58.221 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(20)
1:59.285 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(20)
2:00.348 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(20)
2:01.642 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(20)
2:02.706 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity lingering_insanity(20)
2:04.298 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity raid_movement, twist_of_fate, lingering_insanity(20), mind_sear_on_hit_reset
2:04.298 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity raid_movement, twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
2:05.559 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.7/100: 82% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:07.548 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
2:08.769 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
2:13.026 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity twist_of_fate, voidform(9), insanity_drain_stacks(5)
2:14.187 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.4/100: 95% insanity twist_of_fate, voidform(10), insanity_drain_stacks(6)
2:15.346 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.7/100: 98% insanity twist_of_fate, voidform(12), insanity_drain_stacks(8)
2:16.484 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity twist_of_fate, voidform(13), insanity_drain_stacks(9)
2:17.609 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity voidform(14), insanity_drain_stacks(10)
2:20.089 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 63.3/100: 63% insanity raid_movement, voidform(16), insanity_drain_stacks(12)
2:21.180 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity voidform(17), insanity_drain_stacks(13)
2:22.270 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 62.5/100: 62% insanity voidform(18), insanity_drain_stacks(14)
2:23.352 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity voidform(20), insanity_drain_stacks(16)
2:24.414 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 47.9/100: 48% insanity voidform(21), insanity_drain_stacks(17)
2:25.468 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 38.1/100: 38% insanity voidform(22), insanity_drain_stacks(18)
2:26.513 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity voidform(23), insanity_drain_stacks(19)
2:27.548 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity voidform(24), insanity_drain_stacks(20)
2:28.576 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 18.8/100: 19% insanity voidform(25), insanity_drain_stacks(21)
2:29.597 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(26)
2:30.611 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(26)
2:32.186 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity lingering_insanity(26), mind_sear_on_hit_reset
2:33.198 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity lingering_insanity(26), mind_sear_on_hit_reset
2:34.211 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(26), mind_sear_on_hit_reset
2:36.193 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity raid_movement, twist_of_fate, lingering_insanity(26), mind_sear_on_hit_reset
2:36.193 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity raid_movement, twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
2:37.453 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.7/100: 88% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:39.388 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.4/100: 95% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
2:40.609 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.1/100: 91% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
2:43.233 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.4/100: 73% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
2:44.411 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.8/100: 79% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
2:45.581 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
2:46.739 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.3/100: 68% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
2:47.881 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.2/100: 68% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
2:50.299 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 37.6/100: 38% insanity raid_movement, voidform(15), insanity_drain_stacks(15)
2:51.408 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
2:52.507 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.1/100: 21% insanity raid_movement, voidform(17), insanity_drain_stacks(17)
2:53.594 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 13.4/100: 13% insanity voidform(18), insanity_drain_stacks(18)
2:54.670 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.0/100: 11% insanity voidform(19), insanity_drain_stacks(19)
2:55.742 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(20)
2:56.806 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(20)
2:57.870 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(20)
2:58.932 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(20)
2:59.995 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(20)
3:01.058 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity lingering_insanity(20)
3:02.122 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity lingering_insanity(20)
3:03.186 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(20)
3:04.711 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.0/100: 99% insanity twist_of_fate, lingering_insanity(20), mind_sear_on_hit_reset
3:04.711 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.0/100: 99% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
3:07.213 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.6/100: 94% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:08.445 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity raid_movement, twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:09.661 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:13.878 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity twist_of_fate, voidform(10), insanity_drain_stacks(6)
3:15.035 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity twist_of_fate, voidform(11), insanity_drain_stacks(7)
3:16.184 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.2/100: 89% insanity twist_of_fate, voidform(12), insanity_drain_stacks(8)
3:17.322 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.8/100: 79% insanity voidform(13), insanity_drain_stacks(9)
3:17.322 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.8/100: 79% insanity berserking, voidform(13), insanity_drain_stacks(9)
3:18.297 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity berserking, voidform(14), insanity_drain_stacks(10)
3:20.247 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 69.5/100: 69% insanity berserking, raid_movement, voidform(16), insanity_drain_stacks(12)
3:21.199 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.7/100: 72% insanity berserking, raid_movement, voidform(17), insanity_drain_stacks(13)
3:22.144 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.4/100: 60% insanity berserking, raid_movement, voidform(18), insanity_drain_stacks(14)
3:23.080 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 52.8/100: 53% insanity berserking, raid_movement, voidform(19), insanity_drain_stacks(15)
3:24.007 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.4/100: 54% insanity berserking, raid_movement, voidform(20), insanity_drain_stacks(16)
3:24.931 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity berserking, raid_movement, voidform(21), insanity_drain_stacks(17)
3:25.845 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 33.7/100: 34% insanity berserking, voidform(22), insanity_drain_stacks(18)
3:26.754 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.3/100: 38% insanity berserking, voidform(23), insanity_drain_stacks(19)
3:27.706 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 33.2/100: 33% insanity voidform(23), insanity_drain_stacks(19)
3:28.744 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 18.3/100: 18% insanity voidform(25), insanity_drain_stacks(21)
3:29.762 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 18.3/100: 18% insanity voidform(26), insanity_drain_stacks(22)
3:30.775 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(27)
3:32.395 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity lingering_insanity(27), mind_sear_on_hit_reset
3:33.400 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity lingering_insanity(27), mind_sear_on_hit_reset
3:35.659 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, lingering_insanity(27), mind_sear_on_hit_reset
3:35.659 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
3:38.161 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:39.394 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:40.873 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.7/100: 69% insanity raid_movement, twist_of_fate, voidform(6), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:42.073 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.1/100: 62% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
3:43.259 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.3/100: 68% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:44.442 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.1/100: 65% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
3:45.612 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.5/100: 53% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
3:46.759 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.1/100: 54% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
3:49.359 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity voidform(14), insanity_drain_stacks(14)
3:50.470 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.9/100: 30% insanity raid_movement, voidform(15), insanity_drain_stacks(15)
3:51.570 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.3/100: 15% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
3:52.660 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(18)
3:53.741 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity lingering_insanity(18)
3:54.822 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity lingering_insanity(18)
3:55.904 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity lingering_insanity(18)
3:56.987 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity raid_movement, lingering_insanity(18)
3:58.070 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity lingering_insanity(18)
3:59.152 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(18)
4:00.235 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity lingering_insanity(18)
4:01.919 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity lingering_insanity(18), mind_sear_on_hit_reset
4:03.001 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity lingering_insanity(18), mind_sear_on_hit_reset
4:04.083 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity lingering_insanity(18), mind_sear_on_hit_reset
4:04.083 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity voidform, insanity_drain_stacks, mind_sear_on_hit_reset
4:06.584 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.9/100: 96% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
4:07.815 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.5/100: 91% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
4:09.737 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6), mind_sear_on_hit_reset
4:12.353 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.9/100: 96% insanity raid_movement, twist_of_fate, voidform(9), insanity_drain_stacks(7), mind_sear_on_hit_reset
4:13.518 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity twist_of_fate, voidform(10), insanity_drain_stacks(8)
4:14.676 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity twist_of_fate, voidform(11), insanity_drain_stacks(9)
4:15.825 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity twist_of_fate, voidform(12), insanity_drain_stacks(10)
4:16.958 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity twist_of_fate, voidform(13), insanity_drain_stacks(11)
4:19.349 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.2/100: 65% insanity twist_of_fate, voidform(16), insanity_drain_stacks(14)
4:20.445 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.3/100: 64% insanity raid_movement, voidform(17), insanity_drain_stacks(15)
4:21.532 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.5/100: 51% insanity raid_movement, voidform(18), insanity_drain_stacks(16)
4:22.612 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 39.4/100: 39% insanity raid_movement, voidform(19), insanity_drain_stacks(17)
4:23.678 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.5/100: 38% insanity voidform(20), insanity_drain_stacks(18)
4:24.741 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 34.1/100: 34% insanity voidform(21), insanity_drain_stacks(19)
4:25.796 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 19.2/100: 19% insanity voidform(22), insanity_drain_stacks(20)
4:26.835 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.5/100: 20% insanity twist_of_fate, voidform(23), insanity_drain_stacks(21)
4:27.864 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 30.5/100: 31% insanity twist_of_fate, voidform(24), insanity_drain_stacks(22)
4:28.886 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 9.7/100: 10% insanity raid_movement, twist_of_fate, voidform(25), insanity_drain_stacks(23)
4:29.901 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.7/100: 6% insanity twist_of_fate, voidform(26), insanity_drain_stacks(24)
4:30.907 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.9/100: 15% insanity twist_of_fate, voidform(27), insanity_drain_stacks(25)
4:31.912 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(28)
4:36.173 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity twist_of_fate, lingering_insanity(28), mind_sear_on_hit_reset
4:37.170 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, lingering_insanity(28), mind_sear_on_hit_reset
4:37.170 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
4:39.194 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.9/100: 90% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
4:40.432 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.4/100: 93% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
4:41.653 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 96% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
4:44.210 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.4/100: 76% insanity raid_movement, twist_of_fate, voidform(8), insanity_drain_stacks(8)
4:45.389 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.8/100: 82% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
4:46.558 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.8/100: 79% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
4:47.714 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.5/100: 84% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
4:48.855 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.9/100: 88% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
4:50.362 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.7/100: 70% insanity raid_movement, twist_of_fate, voidform(14), insanity_drain_stacks(14)
4:51.477 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity raid_movement, twist_of_fate, voidform(15), insanity_drain_stacks(15)
4:52.582 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.5/100: 57% insanity raid_movement, twist_of_fate, voidform(16), insanity_drain_stacks(16)
4:53.676 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.4/100: 42% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
4:54.766 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 40.5/100: 40% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
4:55.842 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.1/100: 37% insanity twist_of_fate, voidform(19), insanity_drain_stacks(19)
4:56.907 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 52.2/100: 52% insanity twist_of_fate, voidform(20), insanity_drain_stacks(20)
4:57.972 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 35.5/100: 36% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21)
4:59.019 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.5/100: 37% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22)
5:00.057 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.7/100: 20% insanity raid_movement, twist_of_fate, voidform(23), insanity_drain_stacks(23)
5:01.087 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.7/100: 29% insanity raid_movement, twist_of_fate, voidform(24), insanity_drain_stacks(24)
5:02.109 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.7/100: 28% insanity twist_of_fate, voidform(25), insanity_drain_stacks(25)
5:03.122 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.7/100: 6% insanity twist_of_fate, voidform(26), insanity_drain_stacks(26)
5:04.759 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.5/100: 9% insanity twist_of_fate, voidform(28), insanity_drain_stacks(28), mind_sear_on_hit_reset
5:05.752 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.9/100: 7% insanity twist_of_fate, voidform(29), insanity_drain_stacks(29), mind_sear_on_hit_reset
5:06.738 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.9/100: 22% insanity twist_of_fate, voidform(30), insanity_drain_stacks(30), mind_sear_on_hit_reset
5:07.721 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.3/100: 14% insanity twist_of_fate, voidform(31), insanity_drain_stacks(31)
5:08.691 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.5/100: 15% insanity twist_of_fate, voidform(32), insanity_drain_stacks(32)
5:10.140 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.7/100: 15% insanity twist_of_fate, voidform(33), insanity_drain_stacks(33), mind_sear_on_hit_reset
5:14.312 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.9/100: 35% insanity twist_of_fate, voidform(38), insanity_drain_stacks(34)
5:15.236 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.1/100: 31% insanity twist_of_fate, voidform(39), insanity_drain_stacks(35)
5:16.155 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.7/100: 12% insanity raid_movement, twist_of_fate, voidform(39), insanity_drain_stacks(35)
5:17.067 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.3/100: 22% insanity raid_movement, twist_of_fate, voidform(40), insanity_drain_stacks(36)
5:17.973 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.7/100: 17% insanity twist_of_fate, voidform(41), insanity_drain_stacks(37)
5:19.980 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity twist_of_fate, lingering_insanity(42)
5:20.880 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity twist_of_fate, lingering_insanity(42)
5:27.519 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, lingering_insanity(42)
5:28.419 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, lingering_insanity(42)
5:30.015 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, lingering_insanity(42)
5:30.015 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, voidform, insanity_drain_stacks
5:32.274 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.4/100: 65% insanity raid_movement, twist_of_fate, voidform(3), insanity_drain_stacks(3)
5:33.742 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
5:34.958 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5)
5:36.406 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
5:37.592 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
5:40.227 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
5:41.372 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.8/100: 59% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
5:42.510 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.9/100: 55% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
5:43.639 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.7/100: 42% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:44.751 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.4/100: 40% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:45.852 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
5:46.949 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.3/100: 46% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:48.031 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.5/100: 44% insanity raid_movement, twist_of_fate, voidform(19), insanity_drain_stacks(19)
5:49.105 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.7/100: 28% insanity raid_movement, twist_of_fate, voidform(20), insanity_drain_stacks(20)
5:50.168 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.7/100: 11% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21)
5:51.220 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.7/100: 11% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22)
5:52.263 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.5/100: 21% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23)
5:53.301 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.5/100: 12% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24)
5:54.327 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.1/100: 11% insanity twist_of_fate, voidform(25), insanity_drain_stacks(25)
5:55.344 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.1/100: 20% insanity twist_of_fate, voidform(26), insanity_drain_stacks(26)
5:56.355 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.8/100: 3% insanity twist_of_fate, voidform(27), insanity_drain_stacks(27)
5:57.356 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.8/100: 1% insanity twist_of_fate, voidform(28), insanity_drain_stacks(28)
5:58.354 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, lingering_insanity(28)
6:03.563 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity twist_of_fate, lingering_insanity(28)
6:04.560 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity raid_movement, twist_of_fate, lingering_insanity(28)
6:05.557 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity twist_of_fate, lingering_insanity(28)
6:06.552 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity twist_of_fate, lingering_insanity(28)
6:09.777 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity twist_of_fate, lingering_insanity(28)
6:09.777 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity twist_of_fate, voidform, insanity_drain_stacks
6:12.515 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.9/100: 82% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
6:13.745 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.5/100: 93% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
6:18.036 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.9/100: 99% insanity twist_of_fate, voidform(9), insanity_drain_stacks(5)
6:18.036 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.9/100: 99% insanity twist_of_fate, voidform(9), insanity_drain_stacks(5), potion_of_deadly_grace
6:19.201 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.4/100: 91% insanity twist_of_fate, voidform(10), insanity_drain_stacks(6), potion_of_deadly_grace
6:19.201 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.4/100: 91% insanity berserking, twist_of_fate, voidform(10), insanity_drain_stacks(6), potion_of_deadly_grace
6:20.206 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity berserking, raid_movement, twist_of_fate, voidform(11), insanity_drain_stacks(7), potion_of_deadly_grace
6:21.202 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity berserking, twist_of_fate, voidform(12), insanity_drain_stacks(8), potion_of_deadly_grace
6:22.190 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.6/100: 92% insanity berserking, twist_of_fate, voidform(13), insanity_drain_stacks(9), potion_of_deadly_grace
6:24.382 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.3/100: 70% insanity berserking, twist_of_fate, voidform(15), insanity_drain_stacks(11), potion_of_deadly_grace
6:25.344 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity berserking, twist_of_fate, voidform(16), insanity_drain_stacks(12), potion_of_deadly_grace
6:26.300 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity berserking, twist_of_fate, voidform(17), insanity_drain_stacks(13), potion_of_deadly_grace
6:27.248 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.9/100: 69% insanity berserking, twist_of_fate, voidform(18), insanity_drain_stacks(14), potion_of_deadly_grace
6:28.184 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.2/100: 74% insanity berserking, twist_of_fate, voidform(19), insanity_drain_stacks(15), potion_of_deadly_grace
6:30.257 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.9/100: 53% insanity twist_of_fate, voidform(21), insanity_drain_stacks(17), potion_of_deadly_grace
6:31.307 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity twist_of_fate, voidform(22), insanity_drain_stacks(18), potion_of_deadly_grace
6:32.353 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.6/100: 45% insanity twist_of_fate, voidform(23), insanity_drain_stacks(19), potion_of_deadly_grace
6:33.386 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.7/100: 60% insanity twist_of_fate, voidform(24), insanity_drain_stacks(20), potion_of_deadly_grace
6:34.409 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity twist_of_fate, voidform(25), insanity_drain_stacks(21), potion_of_deadly_grace
6:36.239 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.4/100: 31% insanity raid_movement, twist_of_fate, voidform(27), insanity_drain_stacks(23), potion_of_deadly_grace
6:37.419 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.4/100: 24% insanity twist_of_fate, voidform(28), insanity_drain_stacks(24), potion_of_deadly_grace
6:38.416 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.7/100: 20% insanity twist_of_fate, voidform(29), insanity_drain_stacks(25), potion_of_deadly_grace
6:39.400 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.7/100: 29% insanity twist_of_fate, voidform(30), insanity_drain_stacks(26), potion_of_deadly_grace
6:40.375 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.2/100: 24% insanity twist_of_fate, voidform(31), insanity_drain_stacks(27), potion_of_deadly_grace
6:42.574 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity twist_of_fate, lingering_insanity(32), potion_of_deadly_grace
6:43.542 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, lingering_insanity(32)
6:50.488 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity twist_of_fate, lingering_insanity(32)
6:51.456 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, lingering_insanity(32)
6:51.456 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, voidform, insanity_drain_stacks

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 32771 32771 20493
Intellect 30857 29150 20439 (729)
Spirit 1 1 0
Health 1966260 1966260 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 30857 29150 0
Crit 32.68% 32.68% 9689
Haste 18.00% 16.84% 5474
Damage / Heal Versatility 2.76% 2.76% 1102
ManaReg per Second 8800 8800 0
Mastery 53.08% 53.08% 4632
Armor 1647 1647 1647
Run Speed 7 0 333

Gear

Source Slot Average Item Level: 858.00
Local Head Hood of Darkened Visions
ilevel: 860, stats: { 219 Armor, +2135 Sta, +1424 Int, +822 Crit, +532 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 865, stats: { +1258 Sta, +1276 Crit, +665 Haste, +333 RunSpeed }
Local Shoulders Roggthread Mantle
ilevel: 845, stats: { 192 Armor, +929 Int, +1393 Sta, +666 Haste, +295 Vers }
Local Chest Maddening Robe of Secrets
ilevel: 850, stats: { 260 Armor, +1945 Sta, +1297 Int, +876 Mastery, +428 Crit }
Local Waist Bonespeaker Cinch
ilevel: 830, stats: { 136 Armor, +807 Int, +1211 Sta, +551 Crit, +356 Mastery }
Local Legs Legwraps of Rampant Turmoil
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +777 Crit, +503 Haste }
Local Feet Norgannon's Foresight
ilevel: 895, stats: { 210 Armor, +2219 Sta, +1479 Int, +662 Haste, +496 Mastery }
Local Wrists Bracers of the High Priest
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +475 Crit, +232 Haste }
Local Hands Handwraps of Delusional Power
ilevel: 855, stats: { 166 Armor, +1529 Sta, +1019 Int, +648 Haste, +349 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste }
Local Finger2 Cursed Warden's Keepsake
ilevel: 865, stats: { +1258 Sta, +1109 Crit, +832 Mastery }, enchant: { +150 Haste }
Local Trinket1 Unstable Horrorslime
ilevel: 860, stats: { +968 Crit }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Gossamer-Spun Greatcloak
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +430 Mastery, +304 Crit }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 878, weapon: { 1480 - 2751, 1.8 }, stats: { +722 Int, +1082 Sta, +315 Crit, +303 Mastery, +9183 Int }, relics: { +45 ilevels, +43 ilevels, +40 ilevels }
Local Off Hand Secrets of the Void
ilevel: 878, stats: { +947 Int, +1421 Sta, +564 Haste, +250 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Raji"
origin="https://us.api.battle.net/wow/character/thrall/Raji/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/153/136128921-avatar.jpg"
level=110
race=troll
role=spell
position=back
professions=tailoring=756/enchanting=715
talents=1212231
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:768:1:771:3:772:1:773:3:774:1:775:3:777:3:778:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1807/1808/1482/3336
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/42/1487/3337
shoulders=roggthread_mantle,id=134177,bonus_id=1727/1507/3336
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/1472
chest=maddening_robe_of_secrets,id=139193,bonus_id=1807/1472
wrists=bracers_of_the_high_priest,id=139762,bonus_id=3386/3384
hands=handwraps_of_delusional_power,id=138212,bonus_id=1807/1808/1477/3336
waist=bonespeaker_cinch,id=134215,bonus_id=3397/1492/1675
legs=legwraps_of_rampant_turmoil,id=137453,bonus_id=1727/1497/3336
feet=norgannons_foresight,id=132455,bonus_id=1811
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1472
finger2=cursed_wardens_keepsake,id=141546,bonus_id=1477/3336,enchant=150haste
trinket1=unstable_horrorslime,id=138224,bonus_id=1807/1808/1482/3336
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=137347/139257/137377/0,relic_id=1727:1507:3337/1807:1472/1727:1492:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=857.88
# gear_stamina=20493
# gear_intellect=20439
# gear_crit_rating=9689
# gear_haste_rating=5474
# gear_mastery_rating=4632
# gear_versatility_rating=1102
# gear_speed_rating=333
# gear_armor=1647

Vait

Vait : 385764 dps, 270748 dps to main target

  • Race: Undead
  • Class: Rogue
  • Spec: Outlaw
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
385764.1 385764.1 551.4 / 0.143% 108734.1 / 28.2% 13738.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
27.9 27.9 Energy 13.83% 63.1 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Vait/advanced
Talents
  • 15: Ghostly Strike (Outlaw Rogue)
  • 30: Grappling Hook (Outlaw Rogue)
  • 45: Deeper Stratagem
  • 60: Cheat Death
  • 75: Dirty Tricks (Outlaw Rogue)
  • 90: Alacrity
  • 100: Marked for Death
  • Talent Calculator
Artifact
Professions
  • herbalism: 114
  • skinning: 800
Scale Factors for Vait Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 13.82 9.86 8.54 7.16 5.55
Normalized 1.00 0.71 0.62 0.52 0.40
Scale Deltas 1138 1138 1138 1138 1138
Error 0.70 0.70 0.69 0.68 0.69
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.82, CritRating=8.54, HasteRating=7.16, MasteryRating=5.55, Versatility=9.86 )

Scale Factors for other metrics

Scale Factors for Vait Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 13.82 9.86 8.54 7.16 5.55
Normalized 1.00 0.71 0.62 0.52 0.40
Scale Deltas 1138 1138 1138 1138 1138
Error 0.70 0.70 0.69 0.68 0.69
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.82, CritRating=8.54, HasteRating=7.16, MasteryRating=5.55, Versatility=9.86 )
Scale Factors for Vait Priority Target Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 9.99 6.88 6.03 4.88 4.46
Normalized 1.00 0.69 0.60 0.49 0.45
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.37 0.37 0.37
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=9.99, CritRating=6.03, HasteRating=4.88, MasteryRating=4.46, Versatility=6.88 )
Scale Factors for Vait Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 13.82 9.86 8.54 7.16 5.55
Normalized 1.00 0.71 0.62 0.52 0.40
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.82, CritRating=8.54, HasteRating=7.16, MasteryRating=5.55, Versatility=9.86 )
Scale Factors for Vait Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for VaitTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Vait 385764
Ambush 2626 0.7% 7.0 64.41sec 149800 149138 Direct 7.0 111659 224020 149799 33.9% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.01 7.01 0.00 0.00 1.0045 0.0000 1049785.01 1543283.41 31.98 149138.37 149138.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.63 66.05% 111659.04 103906 114297 111321.22 0 114297 516876 759857 31.91
crit 2.38 33.95% 224019.87 207812 228593 210269.16 0 228593 532909 783426 30.02
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=2} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
auto_attack_mh 20225 5.3% 256.0 1.57sec 31666 24813 Direct 256.0 27024 54053 31666 36.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 256.04 256.04 0.00 0.00 1.2762 0.0000 8107595.17 11918932.88 31.98 24812.69 24812.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 114.76 44.82% 27023.81 24648 27113 27022.64 26640 27113 3101141 4558972 31.98
crit 92.62 36.18% 54052.95 49296 54225 54052.67 53154 54225 5006454 7359961 31.98
miss 48.66 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 9382 2.4% 237.5 1.69sec 15843 11437 Direct 237.5 13516 27031 15843 36.2% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 237.46 237.46 0.00 0.00 1.3852 0.0000 3762134.86 5530694.61 31.98 11437.25 11437.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.42 44.82% 13516.01 12324 13556 13515.54 13315 13556 1438368 2114537 31.98
crit 85.97 36.20% 27031.46 24648 27113 27031.54 26385 27113 2323767 3416158 31.98
miss 45.08 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Flurry (_attack) 80914 20.8% 416.2 0.98sec 76797 0 Direct 2081.2 15360 0 15360 0.0% 0.0%  

Stats details: blade_flurry_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 416.24 2081.18 0.00 0.00 0.0000 0.0000 31965846.19 46992821.79 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2081.18 100.00% 15359.65 4313 80008 15370.15 13018 18324 31965846 46992822 31.98
 
 

Action details: blade_flurry_attack

Static Values
  • id:22482
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:22482
  • name:Blade Flurry
  • school:physical
  • tooltip:
  • description:{$@spelldesc13877=While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:86259.17
  • base_dd_max:86259.17
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Ghostly Strike 4024 1.0% 27.0 15.05sec 59748 62268 Direct 27.0 43847 87784 59748 36.2% 0.0%  

Stats details: ghostly_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.99 26.99 129.04 0.00 0.9596 2.9878 1612666.92 2370773.13 31.98 3919.58 62267.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.22 63.81% 43846.54 40640 44704 43835.69 41656 44704 755151 1110144 31.98
crit 9.77 36.19% 87783.83 81280 89408 87765.47 82635 89408 857516 1260629 31.98
 
 

Action details: ghostly_strike

Static Values
  • id:196937
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
Spelldata
  • id:196937
  • name:Ghostly Strike
  • school:physical
  • tooltip:Taking {$s5=10}% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take {$s5=10}% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.76
 
Greed 33205 (49808) 8.6% (12.8%) 34.7 11.29sec 568667 0 Direct 116.1 83171 166357 113395 36.3% 0.0%  

Stats details: greed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.74 116.13 0.00 0.00 0.0000 0.0000 13168867.59 19359482.75 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.94 63.67% 83170.64 80816 88897 83201.98 81958 85848 6149667 9040593 31.98
crit 42.19 36.33% 166356.55 161632 177795 166436.23 162440 172946 7019201 10318890 31.98
 
 

Action details: greed

Static Values
  • id:202822
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202822
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
    Greed (_oh) 16604 4.3% 34.7 11.29sec 189583 0 Direct 116.1 41582 83190 56703 36.3% 0.0%  

Stats details: greed_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.73 116.13 0.00 0.00 0.0000 0.0000 6584957.94 9680511.92 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.93 63.66% 41581.96 40408 44449 41597.63 40913 42619 3074034 4519121 31.98
crit 42.20 36.34% 83189.63 80816 88897 83227.33 80816 85867 3510924 5161391 31.98
 
 

Action details: greed_oh

Static Values
  • id:202823
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202823
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Main Gauche 23884 6.2% 240.5 1.69sec 39827 0 Direct 240.5 29248 58499 39828 36.2% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 240.50 240.50 0.00 0.00 0.0000 0.0000 9578472.74 14081262.22 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.51 63.83% 29247.57 26671 29338 29246.39 28897 29338 4489901 6600579 31.98
crit 86.99 36.17% 58499.07 53342 58676 58498.90 57392 58676 5088572 7480683 31.98
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Pistol Shot 7552 2.0% 43.8 8.61sec 69219 71327 Direct 43.8 44892 89778 69220 54.2% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.84 43.84 0.00 0.00 0.9705 0.0000 3034734.23 4461346.78 31.98 71326.63 71326.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.08 45.80% 44891.62 40890 44979 44889.93 43720 44979 901465 1325239 31.98
crit 23.76 54.20% 89777.75 81779 89957 89774.29 87231 89957 2133269 3136108 31.98
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$s1=0} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Potion of the Old War 11977 3.1% 26.3 5.44sec 179729 0 Direct 26.3 131868 264271 179735 36.1% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.33 26.33 0.00 0.00 0.0000 0.0000 4731905.53 6956349.35 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.81 63.85% 131867.54 121121 133233 131850.27 126312 133233 2216798 3258903 31.98
crit 9.52 36.15% 264270.93 242242 266466 264228.70 242242 266466 2515108 3697447 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Run Through 113838 29.6% 99.3 4.00sec 458905 485932 Direct 99.3 336437 672152 458912 36.5% 0.0%  

Stats details: run_through

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.29 99.29 0.00 0.00 0.9444 0.0000 45565842.01 66986103.87 31.98 485931.98 485931.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.07 63.52% 336437.08 258656 387984 336775.81 307236 360129 21219209 31194247 31.98
crit 36.22 36.48% 672152.11 517313 775969 673036.75 614106 731987 24346633 35791857 31.98
 
 

Action details: run_through

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Run Through
  • school:physical
  • tooltip:Rooted.
  • description:Lunging finishing move that causes damage per combo point and has increased range: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
 
Saber Slash 58900 15.4% 216.7 1.85sec 109059 168329 Direct 216.7 80092 160199 109059 36.2% 0.0%  

Stats details: saber_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 216.69 216.69 0.00 0.00 0.6479 0.0000 23631762.29 34740929.02 31.98 168329.38 168329.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.33 63.84% 80092.36 73023 80325 80088.95 79150 80325 11079539 16287972 31.98
crit 78.35 36.16% 160198.91 146046 160650 160197.64 157034 160650 12552223 18452957 31.98
 
 

Action details: saber_slash

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.ss_useable
Spelldata
  • id:193315
  • name:Saber Slash
  • school:physical
  • tooltip:
  • description:Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.75
 
Touch of the Grave 2635 0.7% 24.1 16.89sec 43756 0 Direct 24.1 43756 0 43756 0.0% 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.14 24.14 0.00 0.00 0.0000 0.0000 1056255.49 1056255.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.14 100.00% 43756.09 40074 44082 43752.71 42639 44082 1056255 1056255 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Vait
Adrenaline Rush 5.9 71.13sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.adrenaline_rush.up&energy.deficit>0
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Blade Flurry 10.0 29.99sec

Stats details: blade_flurry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blade_flurry

Static Values
  • id:13877
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:spell_targets.blade_flurry>=2&!buff.blade_flurry.up
Spelldata
  • id:13877
  • name:Blade Flurry
  • school:physical
  • tooltip:Attacking additional enemies. Energy regeneration reduced by $w1%.$?$w2!=0[ Non-Lethal poison application chance increased by $w2%.][]
  • description:While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.
 
Curse of the Dreadblades 4.8 91.85sec

Stats details: curse_of_the_dreadblades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.82 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: curse_of_the_dreadblades

Static Values
  • id:202665
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
Spelldata
  • id:202665
  • name:Curse of the Dreadblades
  • school:shadow
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Gouge 20.0 18.14sec

Stats details: gouge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.99 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: gouge

Static Values
  • id:1776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dirty_tricks.enabled&combo_points.deficit>=1
Spelldata
  • id:1776
  • name:Gouge
  • school:physical
  • tooltip:Incapacitated.$?$w2!=0[ Damage taken increased by $w2%.][]
  • description:Gouges the eyes of an enemy target, incapacitating for {$d=4 seconds}. Damage will interrupt the effect. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
 
Marked for Death 12.7 24.01sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:raid_event.adds.in>40
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=0} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 16.3 24.34sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.31 0.00 0.00 0.00 0.9521 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.slice_and_dice.enabled
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Sprint 8.3 49.15sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.29 0.00 263.49 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.thraxis_tricksy_treads&!variable.ss_useable
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vanish 6.0 64.19sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:variable.stealth_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 5.9 0.0 71.4sec 71.4sec 21.73% 21.78% 0.0(0.0) 5.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:21.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 114.6 0.0sec 3.5sec 99.34% 100.00% 98.3(111.8) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_alacrity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • alacrity_1:0.35%
  • alacrity_2:0.31%
  • alacrity_3:0.33%
  • alacrity_4:0.33%
  • alacrity_5:0.34%
  • alacrity_6:0.36%
  • alacrity_7:0.38%
  • alacrity_8:0.43%
  • alacrity_9:0.56%
  • alacrity_10:0.76%
  • alacrity_11:0.91%
  • alacrity_12:0.92%
  • alacrity_13:0.84%
  • alacrity_14:0.78%
  • alacrity_15:0.79%
  • alacrity_16:0.82%
  • alacrity_17:0.86%
  • alacrity_18:0.89%
  • alacrity_19:0.91%
  • alacrity_20:87.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=1}% for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blade Flurry 10.0 0.0 30.0sec 30.0sec 50.58% 50.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blade_flurry
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blade_flurry_1:50.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13877
  • name:Blade Flurry
  • tooltip:Attacking additional enemies. Energy regeneration reduced by $w1%.$?$w2!=0[ Non-Lethal poison application chance increased by $w2%.][]
  • description:While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Blood Frenzy 14.2 8.7 28.5sec 17.3sec 45.11% 45.11% 8.7(8.7) 13.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2957.63

Stack Uptimes

  • blood_frenzy_1:45.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 18.21% 0.0(0.0) 1.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Broadsides 4.1 0.0 74.3sec 74.3sec 27.60% 24.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_broadsides
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • broadsides_1:27.60%

Trigger Attempt Success

  • trigger_pct:98.81%

Spelldata details

  • id:193356
  • name:Broadsides
  • tooltip:Your attacks generate {$s1=1} additional combo point.
  • description:Your combo-generating abilities generate {$s1=1} additional combo point for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 4.1 0.0 74.6sec 74.6sec 28.27% 27.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • buried_treasure_1:28.27%

Trigger Attempt Success

  • trigger_pct:98.72%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by {$s1=25}%.
  • description:Your base Energy regeneration is increased by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Curse of the Dreadblades 4.8 0.0 91.9sec 91.9sec 14.19% 14.51% 0.0(0.0) 4.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_curse_of_the_dreadblades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • curse_of_the_dreadblades_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202665
  • name:Curse of the Dreadblades
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:101.00%
Grand Melee 4.1 0.0 74.7sec 74.7sec 28.48% 27.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.67

Stack Uptimes

  • grand_melee_1:28.48%

Trigger Attempt Success

  • trigger_pct:98.69%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=50}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=50}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hidden Blade 7.0 0.0 58.5sec 64.8sec 4.25% 5.20% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_hidden_blade
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hidden_blade_1:4.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202754
  • name:Hidden Blade
  • tooltip:Your next Saber Slash has 100% chance to strike a second time.
  • description:{$@spelldesc202753=Successfully using Ambush guarantees your next Saber Slash will strike an additional time.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Jolly Roger 4.1 0.0 74.1sec 74.1sec 28.45% 28.26% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_jolly_roger
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • jolly_roger_1:28.45%

Trigger Attempt Success

  • trigger_pct:98.91%

Spelldata details

  • id:199603
  • name:Jolly Roger
  • tooltip:Saber Slash has an additional {$s1=25}% chance of striking an additional time.
  • description:Causes Saber Slash to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Opportunity 44.8 18.0 8.9sec 6.3sec 37.24% 37.24% 18.0(18.0) 0.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • opportunity_1:37.24%

Trigger Attempt Success

  • trigger_pct:42.09%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot is free.
  • description:{$@spelldesc193315=Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 111.5sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.9 1.9 11.9sec 11.3sec 11.96% 11.96% 1.9(1.9) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:11.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Roll the Bones 2.9 13.4 129.8sec 24.4sec 98.82% 98.82% 13.4(13.4) 1.9

Buff details

  • buff initial source:Vait
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roll_the_bones_1:98.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shark Infested Waters 4.1 0.0 75.7sec 75.7sec 30.03% 48.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_shark_infested_waters
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shark_infested_waters_1:30.03%

Trigger Attempt Success

  • trigger_pct:99.01%

Spelldata details

  • id:193357
  • name:Shark Infested Waters
  • tooltip:Critical Strike chance increased by {$s1=25}%.
  • description:Increases Critical Strike chance by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Sprint 8.3 0.0 49.4sec 49.4sec 16.46% 12.29% 263.5(263.5) 8.2

Buff details

  • buff initial source:Vait
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:16.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 1.0 0.0 166.0sec 195.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:200.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
True Bearing 4.1 0.0 81.8sec 81.8sec 43.64% 43.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • true_bearing_1:43.64%

Trigger Attempt Success

  • trigger_pct:99.67%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishers reduce the remaining cooldown on many of your abilities by {$s1=2} sec per combo point.
  • description:For the duration of Roll the Bones, each time you use a finishing move, you reduce the remaining cooldown on Adrenaline Rush, Sprint, Between the Eyes, Vanish, Blind, Cloak of Shadows, Riposte, Grappling Hook, Cannonball Barrage, Killing Spree, Marked for Death, and Death from Above by {$s1=2} sec per combo point spent.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 6.0 0.0 64.6sec 64.6sec 0.21% 0.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Vait
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Vait
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Vait
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Vait
ambush Energy 7.0 420.5 60.0 60.0 2496.6
ghostly_strike Energy 27.0 809.7 30.0 30.0 1991.6
roll_the_bones Energy 16.3 212.0 13.0 13.0 0.0
roll_the_bones Combo Points 16.3 89.7 5.5 5.5 0.0
run_through Energy 99.3 2283.7 23.0 23.0 19952.3
run_through Combo Points 99.3 569.7 5.7 5.7 79975.6
saber_slash Energy 216.7 7472.4 34.5 34.5 3162.5
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 12.72 61.36 (9.26%) 4.82 2.25 3.54%
gouge Combo Points 19.99 19.99 (3.02%) 1.00 0.00 0.00%
ghostly_strike Combo Points 26.99 26.99 (4.07%) 1.00 0.00 0.00%
pistol_shot Combo Points 43.84 43.84 (6.62%) 1.00 0.00 0.00%
saber_slash Combo Points 216.69 201.14 (30.35%) 0.93 15.54 7.17%
adrenaline_rush Energy 309.80 1375.25 (12.35%) 4.44 197.11 12.54%
ambush Combo Points 7.01 14.01 (2.11%) 2.00 0.00 0.02%
energy_regen Energy 1427.57 6932.34 (62.25%) 4.86 237.01 3.31%
combat_potency Energy 179.07 2828.62 (25.40%) 15.80 36.44 1.27%
Broadsides Combo Points 75.38 67.46 (10.18%) 0.90 7.91 10.50%
Ruthlessness Combo Points 115.60 131.87 (19.90%) 1.14 0.00 0.00%
Curse of the Dreadblades Combo Points 27.86 95.96 (14.48%) 3.44 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 27.78 27.93
Combo Points 1.65 1.64
Combat End Resource Mean Min Max
Energy 38.20 0.00 100.00
Combo Points 3.18 1.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 2.5%

Procs

Count Interval
Roll the Bones: 1 buff 9.7 37.1sec
Roll the Bones: 2 buffs 5.8 64.2sec
Roll the Bones: 3 buffs 0.6 142.5sec
Roll the Bones: 6 buffs 0.2 149.3sec

Statistics & Data Analysis

Fight Length
Sample Data Vait Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Vait Damage Per Second
Count 9999
Mean 385764.05
Minimum 309929.39
Maximum 539205.96
Spread ( max - min ) 229276.56
Range [ ( max - min ) / 2 * 100% ] 29.72%
Standard Deviation 28131.4494
5th Percentile 344569.60
95th Percentile 435827.49
( 95th Percentile - 5th Percentile ) 91257.89
Mean Distribution
Standard Deviation 281.3286
95.00% Confidence Intervall ( 385212.66 - 386315.45 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 204
0.1% Error 20428
0.1 Scale Factor Error with Delta=300 6755661
0.05 Scale Factor Error with Delta=300 27022646
0.01 Scale Factor Error with Delta=300 675566158
Priority Target DPS
Sample Data Vait Priority Target Damage Per Second
Count 9999
Mean 270747.68
Minimum 224397.66
Maximum 361633.80
Spread ( max - min ) 137236.14
Range [ ( max - min ) / 2 * 100% ] 25.34%
Standard Deviation 15085.7957
5th Percentile 248476.73
95th Percentile 297675.19
( 95th Percentile - 5th Percentile ) 49198.46
Mean Distribution
Standard Deviation 150.8655
95.00% Confidence Intervall ( 270451.99 - 271043.37 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11926
0.1 Scale Factor Error with Delta=300 1942764
0.05 Scale Factor Error with Delta=300 7771057
0.01 Scale Factor Error with Delta=300 194276429
DPS(e)
Sample Data Vait Damage Per Second (Effective)
Count 9999
Mean 385764.05
Minimum 309929.39
Maximum 539205.96
Spread ( max - min ) 229276.56
Range [ ( max - min ) / 2 * 100% ] 29.72%
Damage
Sample Data Vait Damage
Count 9999
Mean 153850825.98
Minimum 113484089.55
Maximum 209061277.98
Spread ( max - min ) 95577188.43
Range [ ( max - min ) / 2 * 100% ] 31.06%
DTPS
Sample Data Vait Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Vait Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Vait Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Vait Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Vait Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Vait Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data VaitTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Vait Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 roll_the_bones,if=!talent.slice_and_dice.enabled
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
0.00 variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
Condition to use Saber Slash when not rerolling RtB or when using SnD
0.00 variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
Condition to use Saber Slash, when you have RtB or not
8 0.00 call_action_list,name=bf
Normal rotation
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
Conditions are here to avoid worthless check if nothing is available
0.00 death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
0.00 slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
B 16.30 roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
0.00 killing_spree,if=energy.time_to_max>5|energy<15
C 0.00 call_action_list,name=build
D 0.00 call_action_list,name=finish,if=!variable.ss_useable
E 20.09 gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1
Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions.bf Blade Flurry
# count action,conditions
F 10.00 cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
G 10.00 blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up
actions.build Builders
# count action,conditions
H 26.99 ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
I 43.84 pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
J 149.45 saber_slash,if=variable.ss_useable
actions.cds Cooldowns
# count action,conditions
K 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=energy.deficit>40
0.00 cannonball_barrage,if=spell_targets.cannonball_barrage>=1
L 5.88 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
M 12.73 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
N 8.30 sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
O 4.83 curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
actions.finish Finishers
# count action,conditions
0.00 between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
P 99.29 run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5
actions.stealth Stealth
# count action,conditions
0.00 variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
Condition to use stealth abilities
Q 7.01 ambush
R 6.03 vanish,if=variable.stealth_condition
0.00 shadowmeld,if=variable.stealth_condition

Sample Sequence

01245QLJHNBOJPJPJPJPJPJPJPRQHIBJGIJBJJJHBMPJPJPJPJPFJIPJPJNPJHGPMPJJPLIKJPJPJPJHPMPJJPJNPFJPJPJBJHJPGIJPIJEJPJOJPMPIPFJPEJPIPJIHGBJIJBEJJHBMBJEJLJFPIJPJJNPJIHJPJGMPJJPIJJEPJJIHPMPEJJFIPJIJNPIJHPGIJLJEPJJIBMPRQHJPOJPJPIPMNPJFPJPEJPJJGHRQPJEJJPLIJHJBMBJJPJFIPJPJJPJIPJHGPJPIJNPJPIJPEHPMPJPFIJPIJPJEPGJHPJJBJIHBOJBMPIPJPFIPJPIPJEHGRQNPMPLJIJEPJJHJPIJJJEPFJJIPJIHJPJEJJPJRQHNBEJIBJBIJPJPIJPEHPJJPJEPJHPOJPJPJPEJPIPJPJHPEJBJIJPHJIPJJIPEJJPILJJHPJJJJPJ

Sample Sequence Table

time name target resources buffs
Pre flask Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 ambush Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.004 adrenaline_rush Fluffy_Pillow 75.3/100: 75% energy | 2.0/6: 33% combo_points bloodlust, hidden_blade, blood_frenzy, potion_of_the_old_war
0:01.004 saber_slash Fluffy_Pillow 75.3/100: 75% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, hidden_blade, blood_frenzy, potion_of_the_old_war
0:01.806 ghostly_strike Fluffy_Pillow 56.1/100: 56% energy | 4.0/6: 67% combo_points bloodlust, adrenaline_rush, opportunity, blood_frenzy, potion_of_the_old_war
0:02.609 sprint Fluffy_Pillow 56.9/100: 57% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, opportunity, blood_frenzy, potion_of_the_old_war
0:02.609 roll_the_bones Fluffy_Pillow 56.9/100: 57% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, opportunity, sprint, blood_frenzy, potion_of_the_old_war
0:03.413 curse_of_the_dreadblades Fluffy_Pillow 75.0/100: 75% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity, shark_infested_waters, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:03.413 saber_slash Fluffy_Pillow 75.0/100: 75% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:04.215 run_through Fluffy_Pillow 72.1/100: 72% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:05.021 saber_slash Fluffy_Pillow 80.7/100: 81% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:05.824 run_through Fluffy_Pillow 94.1/100: 94% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:06.629 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:07.434 run_through Fluffy_Pillow 81.8/100: 82% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:08.239 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(5), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:09.044 run_through Fluffy_Pillow 98.4/100: 98% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(5), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:09.846 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(6), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:10.651 run_through Fluffy_Pillow 96.8/100: 97% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(6), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:11.458 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:12.260 Waiting 0.800 sec 80.8/100: 81% energy | 6.0/6: 100% combo_points bloodlust, raid_movement, adrenaline_rush, opportunity, alacrity(8), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:13.060 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:13.864 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:14.670 run_through Fluffy_Pillow 81.5/100: 82% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:15.476 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(11), shark_infested_waters, roll_the_bones, potion_of_the_old_war
0:15.476 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, vanish, alacrity(11), shark_infested_waters, roll_the_bones, potion_of_the_old_war
0:16.480 ghostly_strike Fluffy_Pillow 70.2/100: 70% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(11), shark_infested_waters, roll_the_bones, hidden_blade, potion_of_the_old_war
0:17.486 pistol_shot Fluffy_Pillow 60.1/100: 60% energy | 4.0/6: 67% combo_points bloodlust, opportunity, alacrity(11), shark_infested_waters, roll_the_bones, hidden_blade, potion_of_the_old_war
0:18.490 roll_the_bones Fluffy_Pillow 79.9/100: 80% energy | 5.0/6: 83% combo_points bloodlust, alacrity(11), shark_infested_waters, roll_the_bones, hidden_blade, potion_of_the_old_war
0:19.495 saber_slash Fluffy_Pillow 86.9/100: 87% energy | 1.0/6: 17% combo_points bloodlust, alacrity(12), shark_infested_waters, roll_the_bones, hidden_blade, potion_of_the_old_war
0:20.499 blade_flurry Fluffy_Pillow 56.9/100: 57% energy | 3.0/6: 50% combo_points bloodlust, raid_movement, opportunity, alacrity(12), shark_infested_waters, roll_the_bones, potion_of_the_old_war
0:20.499 pistol_shot Fluffy_Pillow 56.9/100: 57% energy | 3.0/6: 50% combo_points bloodlust, raid_movement, blade_flurry, opportunity, alacrity(12), shark_infested_waters, roll_the_bones, potion_of_the_old_war
0:21.503 Waiting 1.700 sec 91.4/100: 91% energy | 4.0/6: 67% combo_points bloodlust, raid_movement, blade_flurry, alacrity(12), shark_infested_waters, roll_the_bones, potion_of_the_old_war
0:23.203 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points bloodlust, blade_flurry, alacrity(12), shark_infested_waters, roll_the_bones
0:24.209 roll_the_bones Fluffy_Pillow 84.6/100: 85% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(12), shark_infested_waters, roll_the_bones
0:25.214 saber_slash Fluffy_Pillow 95.3/100: 95% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(14), buried_treasure, roll_the_bones
0:26.218 saber_slash Fluffy_Pillow 84.9/100: 85% energy | 2.0/6: 33% combo_points bloodlust, blade_flurry, opportunity, alacrity(14), buried_treasure, roll_the_bones
0:27.223 saber_slash Fluffy_Pillow 58.6/100: 59% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, opportunity, alacrity(14), buried_treasure, roll_the_bones
0:28.227 Waiting 0.800 sec 64.3/100: 64% energy | 4.0/6: 67% combo_points bloodlust, raid_movement, blade_flurry, opportunity, alacrity(14), buried_treasure, roll_the_bones
0:29.027 ghostly_strike Fluffy_Pillow 83.1/100: 83% energy | 4.0/6: 67% combo_points bloodlust, blade_flurry, opportunity, alacrity(14), buried_treasure, roll_the_bones
0:30.031 roll_the_bones Fluffy_Pillow 78.6/100: 79% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, opportunity, alacrity(14), buried_treasure, roll_the_bones, blood_frenzy
0:31.035 marked_for_death Fluffy_Pillow_Add1 91.4/100: 91% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(15), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:31.035 run_through Fluffy_Pillow 91.4/100: 91% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(15), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:32.037 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(16), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:33.042 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, opportunity, alacrity(16), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:34.048 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(17), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:35.053 run_through Fluffy_Pillow 92.2/100: 92% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, opportunity, alacrity(17), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:36.058 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(18), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:37.062 run_through Fluffy_Pillow 92.4/100: 92% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, opportunity, alacrity(18), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:38.068 saber_slash Fluffy_Pillow 96.1/100: 96% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(19), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:39.072 run_through Fluffy_Pillow 72.8/100: 73% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, opportunity, alacrity(19), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:40.077 cancel_buff Fluffy_Pillow 76.7/100: 77% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:40.077 saber_slash Fluffy_Pillow 76.7/100: 77% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:41.082 pistol_shot Fluffy_Pillow 54.3/100: 54% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:42.088 run_through Fluffy_Pillow 76.6/100: 77% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:43.093 saber_slash Fluffy_Pillow 75.8/100: 76% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:44.097 Waiting 0.900 sec 48.1/100: 48% energy | 5.0/6: 83% combo_points raid_movement, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:44.997 run_through Fluffy_Pillow 68.0/100: 68% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:46.000 saber_slash Fluffy_Pillow 67.2/100: 67% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:47.006 sprint Fluffy_Pillow 55.5/100: 55% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:47.006 run_through Fluffy_Pillow 55.5/100: 55% energy | 5.0/6: 83% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:48.010 saber_slash Fluffy_Pillow 70.7/100: 71% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:49.014 ghostly_strike Fluffy_Pillow 42.2/100: 42% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones
0:50.020 blade_flurry Fluffy_Pillow 64.8/100: 65% energy | 5.0/6: 83% combo_points raid_movement, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones
0:50.020 Waiting 2.000 sec 64.8/100: 65% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones
0:52.020 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones
0:53.024 marked_for_death Fluffy_Pillow_Add1 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones
0:53.024 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones
0:54.030 saber_slash Fluffy_Pillow 96.2/100: 96% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones
0:55.035 saber_slash Fluffy_Pillow 65.4/100: 65% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones
0:56.040 run_through Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:57.044 adrenaline_rush Fluffy_Pillow 33.7/100: 34% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:57.044 pistol_shot Fluffy_Pillow 33.7/100: 34% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:57.850 potion Fluffy_Pillow 66.9/100: 67% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy
0:58.000 saber_slash Fluffy_Pillow 73.1/100: 73% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:58.805 run_through Fluffy_Pillow 88.3/100: 88% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:59.612 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:00.418 Waiting 0.600 sec 99.2/100: 99% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:01.018 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:01.822 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:02.628 run_through Fluffy_Pillow 83.2/100: 83% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:03.432 saber_slash Fluffy_Pillow 93.3/100: 93% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:04.236 ghostly_strike Fluffy_Pillow 92.4/100: 92% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:05.041 run_through Fluffy_Pillow 95.6/100: 96% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:05.847 marked_for_death Fluffy_Pillow_Add1 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:05.847 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:06.651 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:07.456 saber_slash Fluffy_Pillow 83.1/100: 83% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:08.261 run_through Fluffy_Pillow 95.8/100: 96% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:09.066 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:09.872 sprint Fluffy_Pillow 80.7/100: 81% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:09.872 run_through Fluffy_Pillow 80.7/100: 81% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:10.678 cancel_buff Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:10.678 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:11.481 run_through Fluffy_Pillow 98.9/100: 99% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:12.286 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:13.292 run_through Fluffy_Pillow 86.6/100: 87% energy | 5.0/6: 83% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:14.296 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:15.302 roll_the_bones Fluffy_Pillow 86.6/100: 87% energy | 5.0/6: 83% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, shark_infested_waters, true_bearing, broadsides, buried_treasure, roll_the_bones, potion_of_the_old_war
1:16.305 Waiting 0.400 sec 90.1/100: 90% energy | 1.0/6: 17% combo_points raid_movement, opportunity, sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:16.705 saber_slash Fluffy_Pillow 96.6/100: 97% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:17.709 ghostly_strike Fluffy_Pillow 95.1/100: 95% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:18.713 saber_slash Fluffy_Pillow 81.6/100: 82% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:19.717 run_through Fluffy_Pillow 48.1/100: 48% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:20.722 blade_flurry Fluffy_Pillow 41.5/100: 42% energy | 2.0/6: 33% combo_points raid_movement, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:20.722 pistol_shot Fluffy_Pillow 41.5/100: 42% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:21.725 Waiting 1.400 sec 56.8/100: 57% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:23.125 saber_slash Fluffy_Pillow 78.2/100: 78% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:24.129 run_through Fluffy_Pillow 75.5/100: 76% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:25.133 pistol_shot Fluffy_Pillow 67.8/100: 68% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:26.138 saber_slash Fluffy_Pillow 83.2/100: 83% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:27.143 gouge Fluffy_Pillow 48.5/100: 49% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:28.146 saber_slash Fluffy_Pillow 79.8/100: 80% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:29.151 run_through Fluffy_Pillow 45.1/100: 45% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:30.157 Waiting 0.900 sec 37.5/100: 37% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:31.057 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:32.060 Waiting 1.156 sec 16.5/100: 17% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:33.216 curse_of_the_dreadblades Fluffy_Pillow 34.2/100: 34% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones
1:33.413 Waiting 0.800 sec 37.2/100: 37% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:34.213 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:35.217 Waiting 0.492 sec 16.9/100: 17% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:35.709 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:36.713 marked_for_death Fluffy_Pillow_Add1 18.5/100: 19% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:36.713 Waiting 0.393 sec 18.5/100: 19% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:37.106 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:38.110 pistol_shot Fluffy_Pillow 34.5/100: 35% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:39.113 run_through Fluffy_Pillow 51.1/100: 51% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:40.117 cancel_buff Fluffy_Pillow 60.6/100: 61% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:40.117 saber_slash Fluffy_Pillow 60.6/100: 61% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:41.120 run_through Fluffy_Pillow 44.4/100: 44% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:42.124 gouge Fluffy_Pillow 39.2/100: 39% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:43.130 saber_slash Fluffy_Pillow 57.0/100: 57% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:44.134 run_through Fluffy_Pillow 23.8/100: 24% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:45.137 pistol_shot Fluffy_Pillow 17.3/100: 17% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:46.142 run_through Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:47.148 Waiting 0.300 sec 45.9/100: 46% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:47.448 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:48.453 pistol_shot Fluffy_Pillow 19.0/100: 19% energy | 4.0/6: 67% combo_points raid_movement, opportunity, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:49.457 ghostly_strike Fluffy_Pillow 36.8/100: 37% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:50.461 blade_flurry Fluffy_Pillow 24.6/100: 25% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:50.461 roll_the_bones Fluffy_Pillow 24.6/100: 25% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, shark_infested_waters, roll_the_bones, blood_frenzy
1:51.467 Waiting 1.700 sec 28.2/100: 28% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
1:53.167 saber_slash Fluffy_Pillow 56.2/100: 56% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
1:54.172 pistol_shot Fluffy_Pillow 38.7/100: 39% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
1:55.177 saber_slash Fluffy_Pillow 55.2/100: 55% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
1:56.179 roll_the_bones Fluffy_Pillow 20.5/100: 21% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
1:57.184 gouge Fluffy_Pillow 22.9/100: 23% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
1:58.189 Waiting 0.600 sec 38.2/100: 38% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
1:58.789 saber_slash Fluffy_Pillow 63.3/100: 63% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
1:59.796 saber_slash Fluffy_Pillow 60.7/100: 61% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
2:00.800 Waiting 0.300 sec 26.0/100: 26% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
2:01.100 ghostly_strike Fluffy_Pillow 30.6/100: 31% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
2:02.103 roll_the_bones Fluffy_Pillow 15.9/100: 16% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
2:03.108 Waiting 1.943 sec 18.2/100: 18% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones
2:05.051 marked_for_death Fluffy_Pillow_Add1 47.9/100: 48% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones
2:05.051 roll_the_bones Fluffy_Pillow 47.9/100: 48% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones
2:06.056 saber_slash Fluffy_Pillow 50.2/100: 50% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:07.062 gouge Fluffy_Pillow 32.8/100: 33% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:08.190 saber_slash Fluffy_Pillow 67.4/100: 67% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:09.195 adrenaline_rush Fluffy_Pillow 49.9/100: 50% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:09.195 Waiting 0.100 sec 49.9/100: 50% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:09.295 saber_slash Fluffy_Pillow 53.2/100: 53% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:10.098 cancel_buff Fluffy_Pillow 29.7/100: 30% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:10.098 run_through Fluffy_Pillow 29.7/100: 30% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:10.901 pistol_shot Fluffy_Pillow 35.1/100: 35% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:11.706 saber_slash Fluffy_Pillow 79.7/100: 80% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:12.511 run_through Fluffy_Pillow 74.2/100: 74% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:13.316 saber_slash Fluffy_Pillow 79.7/100: 80% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:14.121 saber_slash Fluffy_Pillow 74.2/100: 74% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:14.926 sprint Fluffy_Pillow 68.7/100: 69% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:14.926 run_through Fluffy_Pillow 68.7/100: 69% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:15.729 saber_slash Fluffy_Pillow 74.2/100: 74% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:16.531 pistol_shot Fluffy_Pillow 52.6/100: 53% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:17.334 ghostly_strike Fluffy_Pillow 81.1/100: 81% energy | 3.0/6: 50% combo_points adrenaline_rush, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:18.137 saber_slash Fluffy_Pillow 79.5/100: 80% energy | 4.0/6: 67% combo_points adrenaline_rush, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:18.942 run_through Fluffy_Pillow 74.0/100: 74% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:19.746 saber_slash Fluffy_Pillow 79.5/100: 80% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:20.551 blade_flurry Fluffy_Pillow 58.0/100: 58% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:20.551 marked_for_death Fluffy_Pillow_Add1 58.0/100: 58% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:20.551 run_through Fluffy_Pillow 58.0/100: 58% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:21.357 saber_slash Fluffy_Pillow 77.6/100: 78% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:22.162 saber_slash Fluffy_Pillow 70.1/100: 70% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:22.967 run_through Fluffy_Pillow 46.6/100: 47% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:23.770 pistol_shot Fluffy_Pillow 50.1/100: 50% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:24.575 saber_slash Fluffy_Pillow 86.4/100: 86% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:25.580 saber_slash Fluffy_Pillow 68.7/100: 69% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:26.584 gouge Fluffy_Pillow 50.0/100: 50% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:27.590 run_through Fluffy_Pillow 65.3/100: 65% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:28.594 saber_slash Fluffy_Pillow 57.7/100: 58% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:29.598 Waiting 1.832 sec 23.0/100: 23% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:31.430 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:32.435 pistol_shot Fluffy_Pillow 16.3/100: 16% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:33.440 ghostly_strike Fluffy_Pillow 48.8/100: 49% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:34.444 run_through Fluffy_Pillow 35.4/100: 35% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:35.448 marked_for_death Fluffy_Pillow_Add1 28.9/100: 29% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:35.448 run_through Fluffy_Pillow 28.9/100: 29% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:36.453 Waiting 0.554 sec 22.5/100: 22% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:37.007 gouge Fluffy_Pillow 31.6/100: 32% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:38.012 saber_slash Fluffy_Pillow 64.1/100: 64% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:39.016 Waiting 0.300 sec 46.7/100: 47% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:39.316 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:40.318 cancel_buff Fluffy_Pillow 18.1/100: 18% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:40.318 pistol_shot Fluffy_Pillow 18.1/100: 18% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:41.321 run_through Fluffy_Pillow 51.9/100: 52% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:42.325 saber_slash Fluffy_Pillow 62.7/100: 63% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:43.331 pistol_shot Fluffy_Pillow 29.3/100: 29% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:44.337 Waiting 0.300 sec 46.0/100: 46% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:44.637 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:45.640 sprint Fluffy_Pillow 51.1/100: 51% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:45.640 run_through Fluffy_Pillow 51.1/100: 51% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:46.646 pistol_shot Fluffy_Pillow 61.9/100: 62% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:47.652 saber_slash Fluffy_Pillow 79.8/100: 80% energy | 2.0/6: 33% combo_points sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:48.659 ghostly_strike Fluffy_Pillow 63.6/100: 64% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:49.663 run_through Fluffy_Pillow 67.4/100: 67% energy | 5.0/6: 83% combo_points opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:50.669 blade_flurry Fluffy_Pillow 62.2/100: 62% energy | 1.0/6: 17% combo_points raid_movement, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:50.669 pistol_shot Fluffy_Pillow 62.2/100: 62% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:51.674 Waiting 0.300 sec 78.8/100: 79% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:51.974 saber_slash Fluffy_Pillow 99.7/100: 100% energy | 2.0/6: 33% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:52.978 adrenaline_rush Fluffy_Pillow 66.3/100: 66% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:53.195 saber_slash Fluffy_Pillow 69.8/100: 70% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:54.002 gouge Fluffy_Pillow 46.4/100: 46% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:55.006 run_through Fluffy_Pillow 77.5/100: 77% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:55.809 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:56.612 saber_slash Fluffy_Pillow 74.5/100: 75% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:57.416 pistol_shot Fluffy_Pillow 65.0/100: 65% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:58.220 roll_the_bones Fluffy_Pillow 89.6/100: 90% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, grand_melee, true_bearing, roll_the_bones
2:59.024 marked_for_death Fluffy_Pillow_Add1 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:59.024 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:59.829 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:59.829 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, vanish, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:00.834 ghostly_strike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade
3:01.638 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade
3:02.443 run_through Fluffy_Pillow 90.6/100: 91% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:03.248 curse_of_the_dreadblades Fluffy_Pillow 92.1/100: 92% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:03.413 saber_slash Fluffy_Pillow 97.2/100: 97% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:04.218 run_through Fluffy_Pillow 87.7/100: 88% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:05.021 saber_slash Fluffy_Pillow 89.2/100: 89% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:05.826 run_through Fluffy_Pillow 63.8/100: 64% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:06.630 pistol_shot Fluffy_Pillow 65.3/100: 65% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:07.435 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:08.239 marked_for_death Fluffy_Pillow_Add1 100.0/100: 100% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:08.239 sprint Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:08.239 Waiting 0.500 sec 100.0/100: 100% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:08.739 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:09.743 saber_slash Fluffy_Pillow 92.3/100: 92% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:10.748 cancel_buff Fluffy_Pillow 73.6/100: 74% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:10.748 run_through Fluffy_Pillow 73.6/100: 74% energy | 6.0/6: 100% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:11.752 saber_slash Fluffy_Pillow 83.1/100: 83% energy | 1.0/6: 17% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:12.757 run_through Fluffy_Pillow 49.6/100: 50% energy | 6.0/6: 100% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:13.763 gouge Fluffy_Pillow 43.1/100: 43% energy | 1.0/6: 17% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:14.767 saber_slash Fluffy_Pillow 75.6/100: 76% energy | 2.0/6: 33% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
3:15.774 run_through Fluffy_Pillow 42.1/100: 42% energy | 6.0/6: 100% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:16.778 Waiting 0.900 sec 35.6/100: 36% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
3:17.678 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
3:18.682 Waiting 1.100 sec 32.8/100: 33% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
3:19.782 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
3:20.785 blade_flurry Fluffy_Pillow 17.3/100: 17% energy | 3.0/6: 50% combo_points raid_movement, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:20.785 Waiting 2.404 sec 17.3/100: 17% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:23.189 ghostly_strike Fluffy_Pillow 54.0/100: 54% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:24.195 Waiting 0.400 sec 55.3/100: 55% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:24.595 vanish Fluffy_Pillow 61.4/100: 61% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:24.595 Waiting 0.400 sec 61.4/100: 61% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, vanish, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:24.995 ambush Fluffy_Pillow 67.5/100: 68% energy | 4.0/6: 67% combo_points blade_flurry, vanish, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:25.998 run_through Fluffy_Pillow 54.8/100: 55% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade
3:27.003 saber_slash Fluffy_Pillow 63.2/100: 63% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade
3:28.008 gouge Fluffy_Pillow 44.5/100: 44% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:29.014 saber_slash Fluffy_Pillow 75.8/100: 76% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:30.019 Waiting 0.600 sec 41.2/100: 41% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
3:30.619 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
3:31.624 run_through Fluffy_Pillow 33.6/100: 34% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
3:32.630 adrenaline_rush Fluffy_Pillow 43.1/100: 43% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
3:32.630 pistol_shot Fluffy_Pillow 43.1/100: 43% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
3:33.435 saber_slash Fluffy_Pillow 85.7/100: 86% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
3:34.240 ghostly_strike Fluffy_Pillow 78.2/100: 78% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
3:35.043 saber_slash Fluffy_Pillow 90.6/100: 91% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
3:35.849 roll_the_bones Fluffy_Pillow 83.2/100: 83% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), blood_frenzy
3:36.654 marked_for_death Fluffy_Pillow_Add1 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, roll_the_bones, blood_frenzy
3:36.654 roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, roll_the_bones, blood_frenzy
3:37.458 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
3:38.264 saber_slash Fluffy_Pillow 76.6/100: 77% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
3:39.068 run_through Fluffy_Pillow 85.0/100: 85% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
3:39.872 saber_slash Fluffy_Pillow 88.5/100: 89% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
3:40.677 cancel_buff Fluffy_Pillow 63.6/100: 64% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
3:40.677 pistol_shot Fluffy_Pillow 63.6/100: 64% energy | 3.0/6: 50% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
3:41.482 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), grand_melee, broadsides, roll_the_bones
3:42.286 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, broadsides, roll_the_bones
3:43.092 run_through Fluffy_Pillow 76.4/100: 76% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
3:43.897 saber_slash Fluffy_Pillow 79.9/100: 80% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
3:44.702 saber_slash Fluffy_Pillow 88.3/100: 88% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
3:45.508 run_through Fluffy_Pillow 64.7/100: 65% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
3:46.311 saber_slash Fluffy_Pillow 84.1/100: 84% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
3:47.117 pistol_shot Fluffy_Pillow 60.5/100: 61% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
3:47.921 run_through Fluffy_Pillow 98.1/100: 98% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
3:48.927 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
3:49.932 ghostly_strike Fluffy_Pillow 66.5/100: 66% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
3:50.937 blade_flurry Fluffy_Pillow 53.0/100: 53% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), grand_melee, broadsides, roll_the_bones
3:50.937 Waiting 2.200 sec 53.0/100: 53% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
3:53.137 run_through Fluffy_Pillow 86.5/100: 87% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
3:54.141 saber_slash Fluffy_Pillow 94.9/100: 95% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
3:55.146 run_through Fluffy_Pillow 60.2/100: 60% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
3:56.150 pistol_shot Fluffy_Pillow 53.1/100: 53% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
3:57.155 saber_slash Fluffy_Pillow 85.6/100: 86% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
3:58.160 sprint Fluffy_Pillow 68.2/100: 68% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
3:58.160 run_through Fluffy_Pillow 68.2/100: 68% energy | 5.0/6: 83% combo_points blade_flurry, sprint, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
3:59.165 saber_slash Fluffy_Pillow 61.8/100: 62% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
4:00.170 run_through Fluffy_Pillow 28.3/100: 28% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, sprint, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
4:01.176 pistol_shot Fluffy_Pillow 21.9/100: 22% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, sprint, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
4:02.183 saber_slash Fluffy_Pillow 54.5/100: 54% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
4:03.187 run_through Fluffy_Pillow 37.0/100: 37% energy | 5.0/6: 83% combo_points blade_flurry, sprint, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
4:04.192 gouge Fluffy_Pillow 30.6/100: 31% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
4:05.197 ghostly_strike Fluffy_Pillow 47.1/100: 47% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
4:06.201 run_through Fluffy_Pillow 49.6/100: 50% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:07.207 marked_for_death Fluffy_Pillow_Add1 58.0/100: 58% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:07.207 run_through Fluffy_Pillow 58.0/100: 58% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:08.213 saber_slash Fluffy_Pillow 66.3/100: 66% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:09.215 run_through Fluffy_Pillow 31.6/100: 32% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
4:10.219 cancel_buff Fluffy_Pillow 39.9/100: 40% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
4:10.219 pistol_shot Fluffy_Pillow 39.9/100: 40% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
4:11.224 saber_slash Fluffy_Pillow 72.4/100: 72% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
4:12.230 Waiting 0.800 sec 38.9/100: 39% energy | 6.0/6: 100% combo_points raid_movement, opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
4:13.030 run_through Fluffy_Pillow 52.0/100: 52% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
4:14.036 pistol_shot Fluffy_Pillow 61.5/100: 62% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
4:15.040 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
4:16.044 run_through Fluffy_Pillow 66.5/100: 66% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
4:17.048 saber_slash Fluffy_Pillow 59.9/100: 60% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
4:18.054 gouge Fluffy_Pillow 26.4/100: 26% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
4:19.058 run_through Fluffy_Pillow 42.9/100: 43% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
4:20.063 blade_flurry Fluffy_Pillow 36.4/100: 36% energy | 1.0/6: 17% combo_points raid_movement, alacrity(20), grand_melee, broadsides, roll_the_bones
4:20.063 Waiting 3.100 sec 36.4/100: 36% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:23.163 saber_slash Fluffy_Pillow 83.7/100: 84% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:24.167 ghostly_strike Fluffy_Pillow 81.0/100: 81% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:25.171 run_through Fluffy_Pillow 66.3/100: 66% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:26.175 saber_slash Fluffy_Pillow 74.6/100: 75% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:27.181 saber_slash Fluffy_Pillow 56.0/100: 56% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:28.187 Waiting 0.100 sec 53.3/100: 53% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:28.287 roll_the_bones Fluffy_Pillow 54.9/100: 55% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, broadsides, roll_the_bones
4:29.292 saber_slash Fluffy_Pillow 57.2/100: 57% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones
4:30.298 pistol_shot Fluffy_Pillow 39.8/100: 40% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, roll_the_bones, blood_frenzy
4:31.302 ghostly_strike Fluffy_Pillow 56.3/100: 56% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones, blood_frenzy
4:32.305 roll_the_bones Fluffy_Pillow 42.8/100: 43% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones, blood_frenzy
4:33.309 curse_of_the_dreadblades Fluffy_Pillow 50.5/100: 51% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
4:33.413 saber_slash Fluffy_Pillow 52.7/100: 53% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:34.418 roll_the_bones Fluffy_Pillow 23.4/100: 23% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:35.424 marked_for_death Fluffy_Pillow_Add1 42.9/100: 43% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:35.424 run_through Fluffy_Pillow 42.9/100: 43% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:36.429 pistol_shot Fluffy_Pillow 52.5/100: 52% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:37.434 run_through Fluffy_Pillow 69.0/100: 69% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:38.440 saber_slash Fluffy_Pillow 78.6/100: 79% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:39.443 run_through Fluffy_Pillow 45.1/100: 45% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:40.449 cancel_buff Fluffy_Pillow 38.7/100: 39% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:40.449 pistol_shot Fluffy_Pillow 38.7/100: 39% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:41.454 run_through Fluffy_Pillow 72.3/100: 72% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:42.458 saber_slash Fluffy_Pillow 65.8/100: 66% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:43.460 run_through Fluffy_Pillow 48.2/100: 48% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:44.465 pistol_shot Fluffy_Pillow 41.7/100: 42% energy | 1.0/6: 17% combo_points raid_movement, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
4:45.472 run_through Fluffy_Pillow 58.2/100: 58% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
4:46.478 saber_slash Fluffy_Pillow 51.7/100: 52% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
4:47.482 gouge Fluffy_Pillow 18.2/100: 18% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
4:48.486 ghostly_strike Fluffy_Pillow 34.7/100: 35% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
4:49.490 Waiting 0.600 sec 37.1/100: 37% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
4:50.090 blade_flurry Fluffy_Pillow 47.0/100: 47% energy | 4.0/6: 67% combo_points raid_movement, alacrity(20), true_bearing, roll_the_bones
4:50.090 Waiting 0.900 sec 47.0/100: 47% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, alacrity(20), true_bearing, roll_the_bones
4:50.990 vanish Fluffy_Pillow 60.7/100: 61% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, alacrity(20), true_bearing, roll_the_bones
4:50.990 Waiting 2.200 sec 60.7/100: 61% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, vanish, alacrity(20), true_bearing, roll_the_bones
4:53.190 ambush Fluffy_Pillow 94.3/100: 94% energy | 4.0/6: 67% combo_points blade_flurry, vanish, alacrity(20), true_bearing, roll_the_bones
4:54.196 sprint Fluffy_Pillow 82.9/100: 83% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
4:54.196 run_through Fluffy_Pillow 82.9/100: 83% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
4:55.200 marked_for_death Fluffy_Pillow_Add1 76.4/100: 76% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
4:55.200 run_through Fluffy_Pillow 76.4/100: 76% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
4:56.205 adrenaline_rush Fluffy_Pillow 70.0/100: 70% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
4:56.205 saber_slash Fluffy_Pillow 70.0/100: 70% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
4:57.007 pistol_shot Fluffy_Pillow 46.4/100: 46% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
4:57.812 saber_slash Fluffy_Pillow 72.9/100: 73% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
4:58.616 gouge Fluffy_Pillow 49.4/100: 49% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
4:59.620 run_through Fluffy_Pillow 82.5/100: 82% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:00.425 Waiting 0.200 sec 86.0/100: 86% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:00.625 saber_slash Fluffy_Pillow 92.6/100: 93% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:01.431 saber_slash Fluffy_Pillow 85.2/100: 85% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:02.235 ghostly_strike Fluffy_Pillow 61.6/100: 62% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:03.040 saber_slash Fluffy_Pillow 58.2/100: 58% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:03.843 run_through Fluffy_Pillow 34.6/100: 35% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:04.647 pistol_shot Fluffy_Pillow 54.1/100: 54% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:05.452 saber_slash Fluffy_Pillow 80.6/100: 81% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:06.257 saber_slash Fluffy_Pillow 57.2/100: 57% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:07.061 Waiting 0.600 sec 33.5/100: 34% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
5:07.661 saber_slash Fluffy_Pillow 51.8/100: 52% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
5:08.467 gouge Fluffy_Pillow 42.4/100: 42% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
5:09.620 run_through Fluffy_Pillow 77.6/100: 78% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
5:10.425 cancel_buff Fluffy_Pillow 79.2/100: 79% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
5:10.425 saber_slash Fluffy_Pillow 79.2/100: 79% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
5:11.231 saber_slash Fluffy_Pillow 71.2/100: 71% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:12.235 pistol_shot Fluffy_Pillow 53.7/100: 54% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:13.239 run_through Fluffy_Pillow 70.1/100: 70% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
5:14.246 saber_slash Fluffy_Pillow 79.6/100: 80% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
5:15.251 pistol_shot Fluffy_Pillow 46.1/100: 46% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:16.255 Waiting 0.800 sec 78.6/100: 79% energy | 4.0/6: 67% combo_points raid_movement, alacrity(20), true_bearing, roll_the_bones
5:17.055 ghostly_strike Fluffy_Pillow 91.7/100: 92% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
5:18.060 saber_slash Fluffy_Pillow 79.5/100: 80% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:19.064 run_through Fluffy_Pillow 63.3/100: 63% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:20.069 saber_slash Fluffy_Pillow 74.1/100: 74% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:21.073 gouge Fluffy_Pillow 41.9/100: 42% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:22.079 saber_slash Fluffy_Pillow 59.7/100: 60% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:23.085 Waiting 0.400 sec 27.6/100: 28% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:23.485 saber_slash Fluffy_Pillow 50.6/100: 51% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:24.489 Waiting 0.371 sec 18.4/100: 18% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:24.860 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:25.864 Waiting 1.794 sec 19.8/100: 20% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:27.658 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:28.663 Waiting 1.718 sec 19.4/100: 19% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:30.381 vanish Fluffy_Pillow 64.9/100: 65% energy | 2.0/6: 33% combo_points alacrity(20)
5:30.381 ambush Fluffy_Pillow 64.9/100: 65% energy | 2.0/6: 33% combo_points vanish, alacrity(20)
5:31.385 ghostly_strike Fluffy_Pillow 37.4/100: 37% energy | 4.0/6: 67% combo_points alacrity(20), hidden_blade
5:32.389 sprint Fluffy_Pillow 23.8/100: 24% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), hidden_blade
5:32.389 roll_the_bones Fluffy_Pillow 23.8/100: 24% energy | 5.0/6: 83% combo_points raid_movement, sprint, alacrity(20), hidden_blade
5:33.394 gouge Fluffy_Pillow 27.3/100: 27% energy | 1.0/6: 17% combo_points sprint, alacrity(20), jolly_roger, roll_the_bones, hidden_blade
5:34.397 saber_slash Fluffy_Pillow 59.8/100: 60% energy | 2.0/6: 33% combo_points sprint, alacrity(20), jolly_roger, roll_the_bones, hidden_blade
5:35.401 pistol_shot Fluffy_Pillow 42.3/100: 42% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), jolly_roger, roll_the_bones
5:36.405 roll_the_bones Fluffy_Pillow 74.7/100: 75% energy | 5.0/6: 83% combo_points sprint, alacrity(20), jolly_roger, roll_the_bones
5:37.410 saber_slash Fluffy_Pillow 78.2/100: 78% energy | 1.0/6: 17% combo_points sprint, alacrity(20), broadsides, roll_the_bones
5:38.413 roll_the_bones Fluffy_Pillow 60.7/100: 61% energy | 5.0/6: 83% combo_points opportunity, sprint, alacrity(20), broadsides, roll_the_bones
5:39.418 pistol_shot Fluffy_Pillow 64.1/100: 64% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), grand_melee, broadsides, roll_the_bones
5:40.423 saber_slash Fluffy_Pillow 80.6/100: 81% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:41.428 run_through Fluffy_Pillow 47.1/100: 47% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:42.431 saber_slash Fluffy_Pillow 56.6/100: 57% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:43.437 run_through Fluffy_Pillow 39.1/100: 39% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
5:44.443 pistol_shot Fluffy_Pillow 32.6/100: 33% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones
5:45.448 saber_slash Fluffy_Pillow 65.1/100: 65% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:46.452 run_through Fluffy_Pillow 47.5/100: 48% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:47.456 gouge Fluffy_Pillow 41.0/100: 41% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:48.461 Waiting 0.600 sec 57.5/100: 57% energy | 3.0/6: 50% combo_points raid_movement, alacrity(20), grand_melee, broadsides, roll_the_bones
5:49.061 ghostly_strike Fluffy_Pillow 67.3/100: 67% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:50.066 run_through Fluffy_Pillow 69.8/100: 70% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:51.071 saber_slash Fluffy_Pillow 63.3/100: 63% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:52.075 Waiting 0.300 sec 29.8/100: 30% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:52.375 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:53.382 Waiting 0.474 sec 17.2/100: 17% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:53.856 run_through Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:54.861 Waiting 0.997 sec 18.5/100: 18% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:55.858 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
5:56.863 Waiting 0.400 sec 33.6/100: 34% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
5:57.263 gouge Fluffy_Pillow 40.7/100: 41% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
5:58.460 run_through Fluffy_Pillow 77.9/100: 78% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
5:59.466 saber_slash Fluffy_Pillow 72.7/100: 73% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
6:00.470 ghostly_strike Fluffy_Pillow 40.5/100: 40% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
6:01.474 run_through Fluffy_Pillow 28.3/100: 28% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
6:02.478 Waiting 0.700 sec 39.1/100: 39% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
6:03.178 curse_of_the_dreadblades Fluffy_Pillow 67.5/100: 67% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
6:03.413 saber_slash Fluffy_Pillow 71.6/100: 72% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:04.418 Waiting 0.600 sec 55.4/100: 55% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:05.018 run_through Fluffy_Pillow 66.1/100: 66% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:06.023 saber_slash Fluffy_Pillow 76.9/100: 77% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:07.027 run_through Fluffy_Pillow 44.2/100: 44% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades
6:08.030 saber_slash Fluffy_Pillow 54.9/100: 55% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:09.035 run_through Fluffy_Pillow 38.7/100: 39% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:10.040 gouge Fluffy_Pillow 33.5/100: 34% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:11.045 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:12.048 run_through Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:13.052 pistol_shot Fluffy_Pillow 45.9/100: 46% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:14.056 run_through Fluffy_Pillow 63.7/100: 64% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:15.060 saber_slash Fluffy_Pillow 58.5/100: 58% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:16.064 run_through Fluffy_Pillow 26.3/100: 26% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones, blood_frenzy
6:17.066 Waiting 0.846 sec 21.0/100: 21% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
6:17.912 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
6:18.916 Waiting 0.468 sec 17.3/100: 17% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
6:19.384 ghostly_strike Fluffy_Pillow 41.0/100: 41% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
6:20.389 Waiting 0.700 sec 27.5/100: 27% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), grand_melee, broadsides, roll_the_bones
6:21.089 run_through Fluffy_Pillow 39.0/100: 39% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
6:22.094 gouge Fluffy_Pillow 32.4/100: 32% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
6:23.098 Waiting 0.100 sec 48.9/100: 49% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
6:23.198 saber_slash Fluffy_Pillow 50.6/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
6:24.204 roll_the_bones Fluffy_Pillow 17.1/100: 17% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, broadsides, roll_the_bones
6:25.208 Waiting 1.000 sec 24.6/100: 25% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones
6:26.208 saber_slash Fluffy_Pillow 61.1/100: 61% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones
6:27.213 pistol_shot Fluffy_Pillow 31.8/100: 32% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones
6:28.218 saber_slash Fluffy_Pillow 52.4/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), buried_treasure, roll_the_bones
6:29.224 run_through Fluffy_Pillow 39.0/100: 39% energy | 5.0/6: 83% combo_points alacrity(20), buried_treasure, roll_the_bones
6:30.229 Waiting 0.300 sec 36.6/100: 37% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones
6:30.529 ghostly_strike Fluffy_Pillow 42.8/100: 43% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones
6:31.532 Waiting 0.400 sec 33.3/100: 33% energy | 2.0/6: 33% combo_points alacrity(20), buried_treasure, roll_the_bones
6:31.932 saber_slash Fluffy_Pillow 57.5/100: 58% energy | 2.0/6: 33% combo_points alacrity(20), buried_treasure, roll_the_bones
6:32.937 pistol_shot Fluffy_Pillow 44.1/100: 44% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones
6:33.940 run_through Fluffy_Pillow 64.9/100: 65% energy | 5.0/6: 83% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:34.943 saber_slash Fluffy_Pillow 64.2/100: 64% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:35.948 saber_slash Fluffy_Pillow 52.4/100: 52% energy | 2.0/6: 33% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:36.954 pistol_shot Fluffy_Pillow 24.7/100: 25% energy | 4.0/6: 67% combo_points raid_movement, opportunity, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:37.959 run_through Fluffy_Pillow 46.9/100: 47% energy | 5.0/6: 83% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:38.963 gouge Fluffy_Pillow 46.2/100: 46% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:39.967 saber_slash Fluffy_Pillow 84.4/100: 84% energy | 2.0/6: 33% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:40.970 saber_slash Fluffy_Pillow 56.6/100: 57% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:41.973 run_through Fluffy_Pillow 28.8/100: 29% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:42.977 pistol_shot Fluffy_Pillow 44.1/100: 44% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:43.982 adrenaline_rush Fluffy_Pillow 66.3/100: 66% energy | 2.0/6: 33% combo_points alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:44.205 saber_slash Fluffy_Pillow 71.3/100: 71% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:45.007 saber_slash Fluffy_Pillow 88.8/100: 89% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:45.813 ghostly_strike Fluffy_Pillow 74.5/100: 74% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:46.617 run_through Fluffy_Pillow 80.1/100: 80% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:47.421 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:48.226 saber_slash Fluffy_Pillow 85.7/100: 86% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:49.030 saber_slash Fluffy_Pillow 71.3/100: 71% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:49.835 saber_slash Fluffy_Pillow 56.9/100: 57% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:50.640 run_through Fluffy_Pillow 58.6/100: 59% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
6:51.445 saber_slash Fluffy_Pillow 71.2/100: 71% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8805 8480 0
Agility 25492 23786 13626 (8132)
Stamina 31123 31123 19786
Intellect 5323 4998 0
Spirit 5 5 0
Health 1867380 1867380 0
Energy 100 100 0
Combo Points 6 6 0
Crit 28.80% 28.80% 4831
Haste 13.92% 13.92% 4524
Damage / Heal Versatility 4.80% 3.86% 1546
Attack Power 38238 35679 0
Mastery 56.72% 56.72% 6223
Armor 2045 2045 2045
Run Speed 8 0 0
Leech 3.42% 3.42% 786

Gear

Source Slot Average Item Level: 855.00
Local Head Magic-Warped Hood
ilevel: 860, stats: { 276 Armor, +2136 Sta, +1424 AgiInt, +939 Mastery, +416 Crit }
Local Neck Brysngamen, Torc of Helheim
ilevel: 845, stats: { +1045 Sta, +1287 Mastery, +514 Vers }, gems: { +150 Vers }
Local Shoulders Biornskin Shoulderpads
ilevel: 830, stats: { 231 Armor, +807 AgiInt, +1211 Sta, +532 Crit, +376 Mastery, +389 Leech }
Local Shirt Rich Purple Silk Shirt
ilevel: 1
Local Chest Scarred Ragefang Chestpiece
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +820 Mastery, +484 Haste }
Local Waist Forest-Lord's Waistwrap
ilevel: 850, stats: { 185 Armor, +1459 Sta, +973 AgiInt, +637 Haste, +342 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Thraxi's Tricksy Treads
ilevel: 895, stats: { 263 Armor, +2219 Sta, +1479 Agi, +745 Crit, +413 Mastery }
Local Wrists Biornskin Bracer
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +479 Crit, +227 Mastery }
Local Hands Dreamsculptor's Gloves
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +615 Haste, +363 Crit }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 850, stats: { +1094 Sta, +997 Haste, +839 Mastery }
Local Finger2 Band of Fused Coral
ilevel: 845, stats: { +1045 Sta, +1287 Haste, +514 Crit }
Local Trinket1 An'she's Token of Guile
ilevel: 835, stats: { +1073 Agi, +397 Leech, +882 Vers }
Local Trinket2 Bloodthirsty Instinct
ilevel: 870, stats: { +1486 Agi }
Local Back Goldscar Pelt
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +216 Crit, +504 Haste }
Local Main Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }, relics: { +43 ilevels, +43 ilevels, +43 ilevels }
Local Off Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }

Talents

Level
15 Ghostly Strike (Outlaw Rogue) Swordmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue)
30 Grappling Hook (Outlaw Rogue) Acrobatic Strikes (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Deeper Stratagem Anticipation Vigor
60 Iron Stomach (Outlaw Rogue) Elusiveness Cheat Death
75 Parley (Outlaw Rogue) Prey on the Weak Dirty Tricks (Outlaw Rogue)
90 Cannonball Barrage (Outlaw Rogue) Alacrity Killing Spree (Outlaw Rogue)
100 Slice and Dice (Outlaw Rogue) Marked for Death Death from Above

Profile

rogue="Vait"
origin="https://us.api.battle.net/wow/character/thrall/Vait/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/196/133742276-avatar.jpg"
level=110
race=undead
role=attack
position=back
professions=skinning=800/herbalism=114
talents=1113322
artifact=44:0:0:0:0:1052:1:1054:1:1056:1:1057:1:1060:3:1061:3:1063:3:1064:3:1065:1:1066:3:1348:1
spec=outlaw

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,if=!talent.slice_and_dice.enabled

# Executed every time the actor is available.
# Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
actions=variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
# Condition to use Saber Slash when not rerolling RtB or when using SnD
actions+=/variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
# Condition to use Saber Slash, when you have RtB or not
actions+=/variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
# Normal rotation
actions+=/call_action_list,name=bf
actions+=/call_action_list,name=cds
# Conditions are here to avoid worthless check if nothing is available
actions+=/call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
actions+=/death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
actions+=/slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions+=/roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
actions+=/killing_spree,if=energy.time_to_max>5|energy<15
actions+=/call_action_list,name=build
actions+=/call_action_list,name=finish,if=!variable.ss_useable
# Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions+=/gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1

# Blade Flurry
actions.bf=cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
actions.bf+=/blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up

# Builders
actions.build=ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
actions.build+=/pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
actions.build+=/saber_slash,if=variable.ss_useable

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/arcane_torrent,if=energy.deficit>40
actions.cds+=/cannonball_barrage,if=spell_targets.cannonball_barrage>=1
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.cds+=/sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
actions.cds+=/curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)

# Finishers
actions.finish=between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
actions.finish+=/run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5

# Stealth
# Condition to use stealth abilities
actions.stealth=variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
actions.stealth+=/ambush
actions.stealth+=/vanish,if=variable.stealth_condition
actions.stealth+=/shadowmeld,if=variable.stealth_condition

head=magicwarped_hood,id=141453,bonus_id=1472
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727/1808/1497/3336,gems=150vers
shoulders=biornskin_shoulderpads,id=134198,bonus_id=3397/41/1492/1675
back=goldscar_pelt,id=133639,bonus_id=1726/1497/3337
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1472
shirt=rich_purple_silk_shirt,id=4335
wrists=biornskin_bracer,id=134192,bonus_id=3432/1502/3336
hands=dreamsculptors_gloves,id=139202,bonus_id=1807/1472
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1808/1472
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=thraxis_tricksy_treads,id=137031,bonus_id=1811
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1807/1472
finger2=band_of_fused_coral,id=134532,bonus_id=1727/1497/3336
trinket1=anshes_token_of_guile,id=139113,bonus_id=3432/41/607/1497/1674
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1492/3337
main_hand=the_dreadblades,id=128872,bonus_id=742,gem_id=137302/139261/137270/0,relic_id=3410:1502:3336/1807:1472/3410:1502:3336/0
off_hand=the_dreadblades,id=134552

# Gear Summary
# gear_ilvl=854.56
# gear_agility=13626
# gear_stamina=19786
# gear_crit_rating=4831
# gear_haste_rating=4524
# gear_mastery_rating=6223
# gear_versatility_rating=1546
# gear_leech_rating=786
# gear_armor=2045

Bowflexn

Bowflexn : 489035 dps, 346802 dps to main target

  • Race: Tauren
  • Class: Shaman
  • Spec: Enhancement
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
489034.9 489034.9 576.7 / 0.118% 112444.3 / 23.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 3.34% 57.7 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced
Talents
  • 15: Boulderfist (Enhancement Shaman)
  • 30: Wind Rush Totem
  • 45: Lightning Surge Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Landslide (Enhancement Shaman)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • enchanting: 127
Scale Factors for Bowflexn Damage Per Second
Mastery Agi Haste Vers Crit
Scale Factors 16.28 15.39 13.26 11.88 10.67
Normalized 1.06 1.00 0.86 0.77 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.73 0.73 0.72 0.73 0.72
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.39, CritRating=10.67, HasteRating=13.26, MasteryRating=16.28, Versatility=11.88 )

Scale Factors for other metrics

Scale Factors for Bowflexn Damage Per Second
Mastery Agi Haste Vers Crit
Scale Factors 16.28 15.39 13.26 11.88 10.67
Normalized 1.06 1.00 0.86 0.77 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.73 0.73 0.72 0.73 0.72
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.39, CritRating=10.67, HasteRating=13.26, MasteryRating=16.28, Versatility=11.88 )
Scale Factors for Bowflexn Priority Target Damage Per Second
Agi Mastery Haste Vers Crit
Scale Factors 10.76 10.39 9.66 8.42 7.46
Normalized 1.00 0.97 0.90 0.78 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.37 0.37 0.38 0.37
Gear Ranking
Optimizers
Ranking
  • Agi ~= Mastery > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=10.76, CritRating=7.46, HasteRating=9.66, MasteryRating=10.39, Versatility=8.42 )
Scale Factors for Bowflexn Damage Per Second (Effective)
Mastery Agi Haste Vers Crit
Scale Factors 16.28 15.39 13.26 11.88 10.67
Normalized 1.06 1.00 0.86 0.77 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.39, CritRating=10.67, HasteRating=13.26, MasteryRating=16.28, Versatility=11.88 )
Scale Factors for Bowflexn Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for BowflexnTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Bowflexn 489035
Boulderfist 35553 7.3% 77.5 5.18sec 183987 156874 Direct 77.5 138181 281982 183986 31.9% 0.0%  

Stats details: boulderfist

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.54 77.54 0.00 0.00 1.1728 0.0000 14265816.08 14265816.08 0.00 156874.09 156874.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.84 68.15% 138181.40 130240 159862 138179.35 135739 142486 7301412 7301412 0.00
crit 24.70 31.85% 281982.47 265689 326118 281981.52 276930 298260 6964404 6964404 0.00
 
 

Action details: boulderfist

Static Values
  • id:201897
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
Spelldata
  • id:201897
  • name:Boulderfist
  • school:nature
  • tooltip:
  • description:Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Crash Lightning 38701 (77454) 7.9% (15.8%) 64.9 6.11sec 473165 405714 Direct 261.2 44084 89926 58741 32.0% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.90 261.15 0.00 0.00 1.1663 0.0000 15340401.03 15340401.03 0.00 405714.35 405714.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.65 68.03% 44083.54 39173 50957 44083.45 43434 45472 7831642 7831642 0.00
crit 83.50 31.97% 89925.83 79913 103952 89926.75 88519 93780 7508759 7508759 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Crashing Storm 38753 7.9% 402.8 0.98sec 38152 0 Direct 1680.0 6861 13998 9147 32.0% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 402.76 1679.97 0.00 0.00 0.0000 0.0000 15366089.76 15366089.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1142.03 67.98% 6861.29 5978 7924 6861.31 6761 7109 7835783 7835783 0.00
crit 537.94 32.02% 13998.28 12195 16165 13998.41 13781 14528 7530307 7530307 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${6*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.140000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Flametongue 6697 (29129) 1.4% (6.0%) 30.3 13.30sec 383803 329520 Direct 30.3 66414 135510 88541 32.0% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.33 30.33 0.00 0.00 1.1647 0.0000 2685147.09 2685147.09 0.00 329519.66 329519.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.61 67.98% 66414.46 65642 76735 66415.17 65642 70209 1369092 1369092 0.00
crit 9.71 32.02% 135509.60 133909 156539 135521.09 133909 148996 1316055 1316055 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.flametongue.remains<gcd
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 22432 4.6% 1096.2 1.16sec 8169 0 Direct 1096.2 6128 12502 8169 32.0% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1096.18 1096.18 0.00 0.00 0.0000 0.0000 8954146.18 8954146.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 745.29 67.99% 6128.43 5337 7075 6128.40 6040 6345 4567444 4567444 0.00
crit 350.89 32.01% 12501.69 10888 14434 12501.72 12316 12940 4386702 4386702 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 4179 (59555) 0.9% (12.2%) 24.5 16.55sec 969261 825746 Direct 24.5 51185 104414 68271 32.1% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.54 24.54 102.29 0.00 1.1738 3.7190 1675272.74 1675272.74 0.00 58122.11 825746.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.66 67.90% 51184.99 50599 59150 51183.92 50599 54400 852806 852806 0.00
crit 7.88 32.10% 104413.69 103223 120666 104412.30 103223 120666 822467 822467 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&buff.frostbrand.remains<gcd
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 55376 11.3% 1073.8 1.18sec 20589 0 Direct 1073.8 15447 31513 20589 32.0% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1073.83 1073.83 0.00 0.00 0.0000 0.0000 22108701.55 22108701.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 730.19 68.00% 15447.32 13711 17835 15447.27 15221 15962 11279566 11279566 0.00
crit 343.64 32.00% 31513.06 27970 36383 31512.92 31074 32545 10829135 10829135 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.35
 
Lava Lash 6167 (11066) 1.3% (2.3%) 16.8 22.74sec 263476 231893 Direct 16.8 111357 227032 148060 31.7% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.77 16.77 0.00 0.00 1.1362 0.0000 2483143.01 2483143.01 0.00 231893.40 231893.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.45 68.28% 111357.03 110066 128666 111339.86 110066 122466 1275141 1275141 0.00
crit 5.32 31.72% 227031.95 224534 262479 225171.70 0 262479 1208002 1208002 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.05
 
    Crash Lightning (lava_lash_cl) 4900 1.0% 8.0 29.84sec 242289 0 Direct 32.9 44068 89891 58755 32.1% 0.0%  

Stats details: lava_lash_cl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.99 32.95 0.00 0.00 0.0000 0.0000 1935817.69 1935817.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.39 67.95% 44067.89 43590 50957 43994.16 0 50957 986591 986591 0.00
crit 10.56 32.05% 89890.78 88924 103952 88992.93 0 103952 949227 949227 0.00
 
 

Action details: lava_lash_cl

Static Values
  • id:195592
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195592
  • name:Crash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
main_hand 9710 2.0% 166.1 2.43sec 23450 12938 Direct 166.1 20530 41896 23450 31.9% 19.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.08 166.08 0.00 0.00 1.8124 0.0000 3894439.50 5725194.96 31.98 12938.47 12938.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.46 49.05% 20530.48 18455 20559 20530.02 20421 20559 1672332 2458486 31.98
crit 53.04 31.94% 41895.89 37648 41940 41895.08 41610 41940 2222108 3266709 31.98
miss 31.58 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 11516 2.4% 24.5 16.32sec 188155 0 Direct 24.5 141344 288471 188150 31.8% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.52 24.52 0.00 0.00 0.0000 0.0000 4613584.17 4613584.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.72 68.18% 141344.10 129230 163652 141344.32 137687 151034 2363096 2363096 0.00
crit 7.80 31.82% 288470.52 263629 333850 288357.35 0 333850 2250488 2250488 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
offhand 4846 1.0% 165.5 2.43sec 11744 6463 Direct 165.5 10269 20954 11744 32.1% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 165.52 165.52 0.00 0.00 1.8170 0.0000 1943968.36 2857817.63 31.98 6463.48 6463.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.03 48.95% 10268.98 9227 10279 10268.81 10219 10279 832111 1223282 31.98
crit 53.06 32.06% 20954.17 18824 20970 20953.92 20809 20970 1111857 1634536 31.98
miss 31.43 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 8977 1.8% 21.5 7.34sec 165313 0 Direct 21.5 124289 253729 165313 31.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.46 21.46 0.00 0.00 0.0000 0.0000 3546956.98 5214362.73 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.66 68.31% 124289.22 118740 124677 124284.47 122981 124677 1821554 2677857 31.98
crit 6.80 31.69% 253729.28 242230 254342 253621.25 0 254342 1725403 2536506 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Stormlash 15575 3.2% 527.0 1.81sec 11841 0 Direct 527.0 11842 0 11842 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 527.03 527.03 0.00 0.00 0.0000 0.0000 6240784.79 6240784.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 527.03 100.00% 11841.52 1223 81158 11848.57 10394 13750 6240785 6240785 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17888.29
  • base_dd_max:17888.29
 
Stormstrike 0 (155092) 0.0% (31.7%) 112.6 3.52sec 548002 470444

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.61 0.00 0.00 0.00 1.1649 0.0000 0.00 0.00 0.00 470443.88 470443.88
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:16.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3&!talent.hailstorm.enabled
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Crash Lightning (stormstrike_cl) 54332 11.0% 81.6 3.59sec 263155 0 Direct 364.8 44159 90085 58849 32.0% 0.0%  

Stats details: stormstrike_cl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.58 364.79 0.00 0.00 0.0000 0.0000 21467913.86 21467913.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 248.11 68.01% 44159.17 43590 50957 44158.77 43590 46298 10956256 10956256 0.00
crit 116.69 31.99% 90085.14 88924 103952 90085.36 88924 95571 10511657 10511657 0.00
 
 

Action details: stormstrike_cl

Static Values
  • id:195592
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195592
  • name:Crash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Stormstrike (_mh) 67163 13.8% 140.8 3.52sec 190547 0 Direct 140.8 143117 291408 190546 32.0% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.78 140.78 0.00 0.00 0.0000 0.0000 26824426.70 39434448.13 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.75 68.02% 143116.52 50109 212961 143399.50 121902 165935 13703501 20145444 31.98
crit 45.03 31.98% 291407.53 102221 434441 292007.09 226112 356723 13120926 19289004 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
    Stormstrike Off-Hand 33597 6.9% 140.8 3.52sec 95322 0 Direct 140.8 71510 145915 95322 32.0% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.78 140.78 0.00 0.00 0.0000 0.0000 13419076.85 19727314.06 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.72 68.00% 71509.57 25054 106481 71652.64 61921 81162 6845151 10063020 31.98
crit 45.05 32.00% 145914.96 51111 217221 146205.49 111075 178628 6573926 9664294 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
Unleash Lava 9023 1.8% 69.2 8.64sec 52073 0 Direct 68.9 39256 80096 52345 32.1% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.23 68.87 0.00 0.00 0.0000 0.0000 3605224.92 3605224.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.80 67.95% 39256.40 38727 45272 39254.77 38727 41715 1837151 1837151 0.00
crit 22.07 32.05% 80095.50 79004 92355 80090.95 79004 86633 1768074 1768074 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 9041 1.9% 69.4 8.59sec 52036 0 Direct 69.1 39257 80080 52308 32.0% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.42 69.06 0.00 0.00 0.0000 0.0000 3612482.12 3612482.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.98 68.03% 39257.23 38727 45272 39255.97 38727 41573 1844445 1844445 0.00
crit 22.08 31.97% 80079.59 79004 92355 80077.40 79004 87348 1768037 1768037 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windfury Attack 22379 4.6% 273.6 3.58sec 32628 0 Direct 273.6 24458 50000 32628 32.0% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 273.58 273.58 0.00 0.00 0.0000 0.0000 8926459.75 13122741.36 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 186.07 68.01% 24457.70 16678 55676 24460.25 19542 30224 4550791 6690093 31.98
crit 87.51 31.99% 49999.59 34023 113579 49996.31 39561 65588 4375669 6432648 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Windfury Attack (_oh) 2693 0.6% 29.1 26.84sec 37090 0 Direct 29.1 27838 56789 37089 32.0% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.06 29.06 0.00 0.00 0.0000 0.0000 1077841.10 1584528.51 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.77 68.04% 27837.51 25017 27838 27837.51 27485 27838 550444 809205 31.98
crit 9.29 31.96% 56788.53 51035 56790 56754.44 0 56790 527397 775323 31.96
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
pet - frost_wolf 233423 / 12037
Frozen Bite 85253 0.9% 9.5 35.89sec 185300 0 Direct 9.5 140116 280251 185311 32.2% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.51 9.51 0.00 0.00 0.0000 0.0000 1761617.44 1761617.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.44 67.76% 140116.29 128063 161680 139465.91 0 161680 902563 902563 0.00
crit 3.07 32.24% 280251.17 256125 323360 262340.86 0 323360 859055 859055 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 51252 0.5% 45.8 6.75sec 23118 23016 Direct 45.8 17504 35017 23118 32.1% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.80 45.80 0.00 0.00 1.0045 0.0000 1058731.48 1556435.56 31.98 23015.90 23015.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.12 67.94% 17504.37 16227 17525 17500.21 0 17525 544671 800718 31.97
crit 14.68 32.06% 35017.42 32454 35050 34982.30 0 35050 514060 755717 31.94
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 96918 1.0% 15.7 19.38sec 126730 0 Direct 40.3 37341 74713 49308 32.0% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.69 40.32 0.00 0.00 0.0000 0.0000 1988221.58 1988221.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.41 67.98% 37340.94 34150 43114 37220.48 0 43114 1023573 1023573 0.00
crit 12.91 32.02% 74712.93 68299 86228 73754.08 0 86228 964648 964648 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 274528 / 13951
Fiery Jaws 125870 1.3% 9.4 35.71sec 271746 0 Direct 9.4 93413 186870 123086 31.7% 0.0%  
Periodic 37.6 37376 0 37376 0.0% 0.0% 9.4%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.44 9.44 37.55 37.55 0.0000 1.0000 2565613.20 2565613.20 0.00 68323.43 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.44 68.25% 93412.69 85376 107787 93125.94 0 107787 601916 601916 0.00
crit 3.00 31.75% 186870.08 170751 215575 173894.64 0 215575 560160 560160 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 100.00% 37376.00 34151 43116 37354.16 0 43116 1403537 1403537 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 96721 1.0% 15.5 19.27sec 126421 0 Direct 39.8 37364 74695 49340 32.1% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.54 39.82 0.00 0.00 0.0000 0.0000 1964809.40 1964809.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.04 67.92% 37363.64 34150 43114 37217.02 0 43114 1010482 1010482 0.00
crit 12.78 32.08% 74695.47 68299 86228 73811.07 0 86228 954328 954328 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 51937 0.5% 45.6 6.70sec 23107 23052 Direct 45.6 17504 35018 23107 32.0% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.59 45.59 0.00 0.00 1.0024 0.0000 1053368.12 1548550.91 31.98 23051.65 23051.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.00 68.01% 17504.30 16227 17525 17497.75 0 17525 542665 797769 31.96
crit 14.58 31.99% 35017.79 32454 35050 34995.50 0 35050 510703 750782 31.96
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 190700 / 9230
melee 81062 0.8% 47.2 6.35sec 32334 32330 Direct 47.2 24481 48979 32334 32.1% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.24 47.24 0.00 0.00 1.0001 0.0000 1527462.15 2245514.04 31.98 32329.98 32329.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.10 67.95% 24481.33 16227 26288 24473.63 0 26288 785813 1155219 31.96
crit 15.14 32.05% 48979.36 32454 52575 48937.01 0 52575 741649 1090295 31.94
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 109637 1.1% 15.8 19.54sec 136847 0 Direct 35.6 45956 91867 60704 32.1% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.79 35.60 0.00 0.00 0.0000 0.0000 2160903.05 2160903.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.16 67.88% 45956.40 24198 64671 46330.84 0 64671 1110428 1110428 0.00
crit 11.43 32.12% 91866.50 48396 129343 91560.71 0 129343 1050475 1050475 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
Bowflexn
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
Doom Winds 6.9 62.30sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.8 120.36sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.78 0.00 0.00 0.00 1.2047 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Wind Shear 14.4 28.33sec

Stats details: wind_shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.38 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wind_shear

Static Values
  • id:57994
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57994
  • name:Wind Shear
  • school:nature
  • tooltip:
  • description:Disrupts the target's concentration with a burst of wind, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 
pet - lightning_wolf
Crackling Surge 9.6 36.33sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.62 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.3 8.5 28.2sec 17.3sec 45.77% 45.77% 8.5(8.5) 13.8

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 11.57% 0.0(0.0) 1.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Boulderfist 2.3 75.3 106.9sec 5.2sec 99.49% 98.31% 75.3(75.3) 1.3

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_boulderfist
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • boulderfist_1:99.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218825
  • name:Boulderfist
  • tooltip:Critical strike chance increased by {$s1=5}%. Damage dealt increased by {$s2=5}%.
  • description:{$@spelldesc201897=Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crash Lightning 10.0 29.3 30.0sec 7.4sec 61.16% 70.06% 29.3(29.3) 10.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_crash_lightning
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crash_lightning_1:61.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187878
  • name:Crash Lightning
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Dirge of Angerboda 3.8 0.0 80.1sec 80.1sec 7.46% 7.46% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_dirge_of_angerboda
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4534.14

Stack Uptimes

  • dirge_of_angerboda_1:7.46%

Trigger Attempt Success

  • trigger_pct:98.62%

Spelldata details

  • id:214807
  • name:Dirge of Angerboda
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 6.9 0.0 62.3sec 62.3sec 10.20% 12.00% 0.0(0.0) 6.8

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Flametongue 4.0 26.3 90.9sec 13.3sec 96.62% 96.56% 45.7(45.7) 3.1

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:96.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 6.7 17.8 55.2sec 16.6sec 95.33% 94.82% 53.4(53.4) 5.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:95.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 45.2 19.7 8.8sec 6.1sec 46.60% 39.95% 19.7(19.7) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:46.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Howl of Ingvar 3.7 0.0 80.6sec 80.5sec 7.41% 7.41% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_howl_of_ingvar
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4534.14

Stack Uptimes

  • howl_of_ingvar_1:7.41%

Trigger Attempt Success

  • trigger_pct:98.61%

Spelldata details

  • id:214802
  • name:Howl of Ingvar
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Landslide 2.3 75.3 106.9sec 5.2sec 99.49% 97.81% 75.3(75.3) 1.3

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:99.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992={$?s201897=false}[Boulderfist][Rockbiter] now also enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 121.8sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Stormbringer 41.0 17.0 9.5sec 6.7sec 34.78% 72.70% 23.4(44.6) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormbringer
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:14.60%
  • stormbringer_2:20.18%

Trigger Attempt Success

  • trigger_pct:84.62%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Each of your main hand attacks has a {$h=5}% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 18.2 11.0 22.2sec 13.6sec 47.19% 47.19% 11.0(11.0) 17.8

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:47.19%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 17.9 10.3 21.8sec 13.6sec 33.22% 40.19% 10.3(10.3) 17.6

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:33.22%

Trigger Attempt Success

  • trigger_pct:20.02%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trugger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wail of Svala 3.8 0.0 79.5sec 79.5sec 7.53% 7.53% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wail_of_svala
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4534.14

Stack Uptimes

  • wail_of_svala_1:7.53%

Trigger Attempt Success

  • trigger_pct:98.51%

Spelldata details

  • id:214803
  • name:Wail of Svala
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Wind Strikes 36.4 32.3 10.8sec 5.6sec 35.57% 53.97% 32.3(32.3) 36.1

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.77

Stack Uptimes

  • wind_strikes_1:35.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=10}% attack speed for {$198293d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 2.1 141.9sec 39.4sec 73.10% 73.10% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.10%

Trigger Attempt Success

  • trigger_pct:99.22%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 2.0 142.4sec 39.5sec 72.96% 72.96% 9.8(9.8) 0.2

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.96%

Trigger Attempt Success

  • trigger_pct:99.07%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 2.1 142.4sec 39.4sec 73.44% 73.44% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.44%

Trigger Attempt Success

  • trigger_pct:99.27%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 2.1 142.0sec 39.1sec 73.12% 73.12% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.12%

Trigger Attempt Success

  • trigger_pct:99.40%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 2.0 140.6sec 38.8sec 73.17% 73.17% 9.8(9.8) 0.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.17%

Trigger Attempt Success

  • trigger_pct:98.99%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 2.1 142.0sec 39.4sec 73.15% 73.15% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.15%

Trigger Attempt Success

  • trigger_pct:99.17%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.7 0.0 30.2sec 30.2sec 76.24% 68.90% 0.0(0.0) 3.1

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.24%

Trigger Attempt Success

  • trigger_pct:99.74%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.8 0.0 30.7sec 30.7sec 76.29% 68.94% 0.0(0.0) 3.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.29%

Trigger Attempt Success

  • trigger_pct:99.82%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Wind Shear16.6370.00136.935218.769142.986315.633
Feral Spirit0.5010.0011.2161.0330.0003.231
Crash Lightning1.5240.00146.90792.83433.663180.822
Boulderfist2.0890.0017.40241.82814.08873.019
Stormstrike2.5420.00121.758326.724176.561501.366
Flametongue4.2300.00141.004117.39553.191193.600
Doom Winds2.6020.00166.13213.5220.66179.940

Resources

Resource Usage Type Count Total Average RPE APR
Bowflexn
crash_lightning Maelstrom 64.9 1297.9 20.0 20.0 23658.3
frostbrand Maelstrom 24.5 490.8 20.0 20.0 48462.9
lava_lash Maelstrom 16.8 503.2 30.0 30.0 8782.5
stormstrike Maelstrom 140.8 2865.0 20.4 25.4 21539.8
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 302.63 1484.26 (28.45%) 4.90 28.92 1.91%
Main Hand Maelstrom 134.50 667.48 (12.79%) 4.96 5.00 0.74%
Off-Hand Maelstrom 134.09 664.13 (12.73%) 4.95 6.34 0.95%
Feral Spirit Maelstrom 107.84 501.95 (9.62%) 4.65 37.26 6.91%
Boulderfist Maelstrom 77.54 1899.18 (36.40%) 24.49 39.25 2.02%
Resource RPS-Gain RPS-Loss
Maelstrom 13.01 12.86
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 59.59 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Flametongue: Windfury Attack 294.7 3.6sec
Frostbrand: Windfury Attack 288.6 3.6sec
Maelstrom Weapon: Windfury Attack 302.6 3.5sec
Stormbringer: Windfury Attack 23.2 17.5sec
Flametongue: main_hand 128.4 3.1sec
Frostbrand: main_hand 126.1 3.2sec
Maelstrom Weapon: main_hand 134.5 3.0sec
Stormbringer: main_hand 11.5 32.5sec
Windfury: main_hand 42.6 9.3sec
Flametongue: offhand 128.4 3.1sec
Frostbrand: offhand 126.2 3.2sec
Maelstrom Weapon: offhand 134.1 3.0sec
Windfury: offhand 14.5 26.8sec
Flametongue: Crash Lightning 256.0 6.2sec
Frostbrand: Crash Lightning 250.5 6.3sec
Stormbringer: Crash Lightning 22.0 18.6sec
Windfury: Crash Lightning 61.2 9.9sec
Flametongue: Stormstrike 136.0 3.6sec
Frostbrand: Stormstrike 132.9 3.7sec
Stormbringer: Stormstrike 11.9 30.3sec
Windfury: Stormstrike 33.0 12.3sec
Unleash Doom: Stormstrike 69.3 6.8sec
Flametongue: Stormstrike Off-Hand 136.0 3.6sec
Frostbrand: Stormstrike Off-Hand 132.9 3.7sec
Unleash Doom: Stormstrike Off-Hand 69.3 6.8sec
Flametongue: Lava Lash 16.8 22.8sec
Frostbrand: Lava Lash 16.8 22.8sec

Statistics & Data Analysis

Fight Length
Sample Data Bowflexn Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Bowflexn Damage Per Second
Count 9999
Mean 489034.91
Minimum 404611.92
Maximum 596147.01
Spread ( max - min ) 191535.08
Range [ ( max - min ) / 2 * 100% ] 19.58%
Standard Deviation 29420.1257
5th Percentile 443309.79
95th Percentile 539647.97
( 95th Percentile - 5th Percentile ) 96338.17
Mean Distribution
Standard Deviation 294.2160
95.00% Confidence Intervall ( 488458.25 - 489611.56 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 139
0.1% Error 13902
0.1 Scale Factor Error with Delta=300 7388779
0.05 Scale Factor Error with Delta=300 29555118
0.01 Scale Factor Error with Delta=300 738877966
Priority Target DPS
Sample Data Bowflexn Priority Target Damage Per Second
Count 9999
Mean 346801.69
Minimum 289532.16
Maximum 404538.36
Spread ( max - min ) 115006.20
Range [ ( max - min ) / 2 * 100% ] 16.58%
Standard Deviation 15176.6430
5th Percentile 322499.51
95th Percentile 372176.38
( 95th Percentile - 5th Percentile ) 49676.87
Mean Distribution
Standard Deviation 151.7740
95.00% Confidence Intervall ( 346504.22 - 347099.16 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7356
0.1 Scale Factor Error with Delta=300 1966233
0.05 Scale Factor Error with Delta=300 7864934
0.01 Scale Factor Error with Delta=300 196623356
DPS(e)
Sample Data Bowflexn Damage Per Second (Effective)
Count 9999
Mean 489034.91
Minimum 404611.92
Maximum 596147.01
Spread ( max - min ) 191535.08
Range [ ( max - min ) / 2 * 100% ] 19.58%
Damage
Sample Data Bowflexn Damage
Count 9999
Mean 183987694.22
Minimum 145038738.93
Maximum 225304382.17
Spread ( max - min ) 80265643.25
Range [ ( max - min ) / 2 * 100% ] 21.81%
DTPS
Sample Data Bowflexn Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Bowflexn Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Bowflexn Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Bowflexn Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Bowflexn Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Bowflexn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BowflexnTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Bowflexn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=seventh_demon
1 0.00 augmentation,type=defiled
2 0.00 food,name=nightborne_delicacy_platter
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
6 14.38 wind_shear
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 33.02 auto_attack
8 3.78 feral_spirit
9 1.09 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
A 1.00 potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
0.00 berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
0.00 blood_fury
B 38.95 crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
C 4.93 boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
D 32.23 boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
0.00 crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
0.00 windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 windstrike,if=buff.stormbringer.react
E 76.32 stormstrike,if=buff.stormbringer.react
F 11.01 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
G 5.93 flametongue,if=buff.flametongue.remains<gcd
0.00 windsong
0.00 ascendance
0.00 fury_of_air,if=!ticking
H 6.87 doom_winds
0.00 crash_lightning,if=active_enemies>=3
0.00 windstrike
I 36.30 stormstrike
0.00 lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
0.00 lava_lash,if=buff.hot_hand.react
0.00 earthen_spike
J 24.89 crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
K 13.53 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
L 4.97 flametongue,if=buff.flametongue.remains<4.8
0.00 sundering
M 16.77 lava_lash,if=maelstrom>=90
0.00 rockbiter
N 19.44 flametongue
O 40.45 boulderfist

Sample Sequence

01247896DFGDHIJMMDJEN7EEIEDEFINOO7BMMOBNO7EBEEEBEEFBC6EEEDL7EIDJKOO7BEEEBL7CEBEEHIBDEEDFL67IDO7BMMKBECEL7BEEIBCEEDIJFD7LO7B6EEIBE8ADBF7EEBEDEGHIEEIDF7BMLMBCMMB6EEFC7BEEDEGI6DJKOO7BMMMBIEDBEGIBF67EDEJDHILJDKO7B7EI6NBEDIBIKNBED7EIDJ6EEDNKO7BO7EB8EIBDML6BKDMO7JIHMNJDO67BEEEFN7BCEIBEENBDEED7FIID6ENO7BIIEBEKN7BDEEBOINDJKOH7JMNMDIJEDEEED7EED6EFIDGJOMO7JKNIJOOMI89EN7DEEEF6EEDEEEHIL7EDEIDFEIDJNOO7JKMOIJNOMJ6

Sample Sequence Table

time name target resources buffs
Pre flask Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre augmentation Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre food Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_the_old_war
0:01.194 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom bloodlust, stormlash, potion_of_the_old_war
0:02.159 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom bloodlust, gathering_storms, stormlash, potion_of_the_old_war
0:02.159 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom bloodlust, gathering_storms, stormlash, potion_of_the_old_war
0:03.123 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom bloodlust, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
0:04.088 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom bloodlust, frostbrand, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
0:05.052 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
0:06.015 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
0:06.015 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, potion_of_the_old_war
0:06.979 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, stormlash, potion_of_the_old_war
0:07.924 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
0:08.828 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, blood_frenzy, potion_of_the_old_war
0:09.731 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, blood_frenzy, potion_of_the_old_war
0:10.632 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, blood_frenzy, potion_of_the_old_war
0:11.534 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, gathering_storms, blood_frenzy, potion_of_the_old_war
0:12.435 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, blood_frenzy, potion_of_the_old_war
0:13.337 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, blood_frenzy, potion_of_the_old_war
0:13.337 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, blood_frenzy, potion_of_the_old_war
0:14.238 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, blood_frenzy, potion_of_the_old_war
0:15.139 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, unleash_doom, blood_frenzy, potion_of_the_old_war
0:16.041 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy, potion_of_the_old_war
0:16.942 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy, potion_of_the_old_war
0:17.843 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy, potion_of_the_old_war
0:18.744 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, unleash_doom, blood_frenzy, potion_of_the_old_war
0:19.645 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, unleash_doom, blood_frenzy, potion_of_the_old_war
0:20.546 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy, potion_of_the_old_war
0:21.448 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy, potion_of_the_old_war
0:22.348 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy, potion_of_the_old_war
0:23.249 Waiting 0.400 sec 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
0:23.649 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
0:23.649 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
0:24.551 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
0:25.452 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
0:26.353 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
0:27.255 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
0:28.158 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
0:29.059 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
0:29.960 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
0:29.960 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
0:30.863 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
0:31.764 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
0:32.666 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
0:33.568 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
0:34.470 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
0:35.429 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
0:36.392 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
0:37.356 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
0:38.321 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
0:39.286 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, unleash_doom, wind_strikes, gathering_storms
0:40.225 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, blood_frenzy
0:40.225 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, blood_frenzy
0:41.162 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
0:42.331 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
0:43.503 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
0:44.672 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
0:45.841 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
0:45.841 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
0:47.010 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
0:48.181 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
0:49.351 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
0:50.566 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash
0:51.819 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash
0:53.072 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, stormlash
0:54.324 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, stormlash
0:54.324 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, stormlash
0:55.578 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
0:56.831 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
0:58.085 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
0:59.338 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
1:00.591 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
1:01.844 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
1:01.844 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
1:03.097 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, gathering_storms
1:04.350 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
1:05.602 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
1:06.854 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
1:08.108 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
1:08.108 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom
1:09.361 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes
1:10.615 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, gathering_storms
1:11.868 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, gathering_storms
1:13.121 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom
1:14.375 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom
1:15.627 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom
1:16.881 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
1:18.134 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:18.134 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:18.134 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:19.387 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:20.641 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:21.893 Waiting 1.700 sec 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:23.593 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:23.593 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:24.762 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
1:25.820 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, blood_frenzy
1:26.877 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, blood_frenzy
1:27.934 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, blood_frenzy
1:28.992 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, wail_of_svala, blood_frenzy
1:30.049 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, wail_of_svala, blood_frenzy
1:31.106 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash, wail_of_svala, blood_frenzy
1:32.161 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala, blood_frenzy
1:33.261 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
1:33.261 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
1:34.489 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
1:35.740 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
1:36.992 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
1:38.244 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:39.496 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
1:40.749 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
1:42.000 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide
1:43.253 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:44.505 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:45.758 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:47.012 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda
1:48.263 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda
1:49.516 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda
1:49.516 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda
1:50.768 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda
1:52.020 Waiting 1.600 sec 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda
1:53.620 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda
1:53.620 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda
1:54.790 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
1:54.790 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
1:55.957 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
1:57.126 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:58.296 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:59.466 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
2:00.635 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
2:01.805 potion Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, blood_frenzy
2:01.805 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, blood_frenzy, potion_of_the_old_war
2:02.975 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy, potion_of_the_old_war
2:04.182 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom raid_movement, flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
2:05.435 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
2:05.435 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
2:06.689 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash, potion_of_the_old_war
2:07.943 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, potion_of_the_old_war
2:09.196 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
2:10.450 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, potion_of_the_old_war
2:11.701 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, potion_of_the_old_war
2:12.952 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, potion_of_the_old_war
2:14.205 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, potion_of_the_old_war
2:14.205 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, potion_of_the_old_war
2:15.459 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, potion_of_the_old_war
2:16.712 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, potion_of_the_old_war
2:17.964 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, potion_of_the_old_war
2:19.216 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, potion_of_the_old_war
2:20.469 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom raid_movement, flametongue, boulderfist, landslide, unleash_doom, potion_of_the_old_war
2:21.721 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, potion_of_the_old_war
2:21.721 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, potion_of_the_old_war
2:22.974 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, potion_of_the_old_war
2:24.226 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
2:25.478 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
2:26.730 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
2:27.982 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
2:29.236 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
2:30.489 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
2:31.741 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
2:32.994 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
2:32.994 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
2:34.247 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes
2:35.501 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
2:36.754 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide
2:38.007 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
2:38.007 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
2:39.177 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
2:40.347 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
2:41.518 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
2:42.689 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
2:43.860 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
2:45.030 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
2:46.199 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
2:46.199 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
2:47.372 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
2:48.544 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
2:49.750 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:51.003 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:52.330 Waiting 0.300 sec 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:52.630 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:52.630 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:53.799 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
2:54.969 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
2:56.141 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
2:57.310 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
2:58.481 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
2:59.650 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
3:00.819 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
3:01.988 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
3:03.194 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms
3:04.445 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:05.698 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:06.950 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
3:08.204 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
3:09.456 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
3:09.456 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
3:09.456 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
3:10.709 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, howl_of_ingvar
3:11.961 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash, howl_of_ingvar
3:13.213 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, howl_of_ingvar
3:14.463 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
3:15.713 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar
3:15.713 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms, howl_of_ingvar
3:16.963 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, howl_of_ingvar
3:18.216 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds
3:19.469 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, gathering_storms
3:20.721 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, gathering_storms
3:21.974 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms
3:23.228 Waiting 0.400 sec 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms
3:23.628 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms
3:23.628 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms
3:24.797 Waiting 0.400 sec 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
3:25.197 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
3:25.197 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
3:26.366 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
3:27.536 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
3:27.536 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
3:28.706 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
3:29.876 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, blood_frenzy
3:31.047 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
3:32.218 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
3:33.388 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
3:34.559 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, blood_frenzy
3:35.729 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
3:36.935 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
3:38.186 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:39.438 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
3:40.690 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
3:41.942 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash
3:41.942 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash
3:43.192 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
3:44.445 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
3:45.697 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
3:46.949 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
3:46.949 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
3:48.203 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash
3:49.456 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash
3:50.706 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
3:51.957 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
3:53.208 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
3:54.460 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
3:54.460 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
3:55.713 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
3:56.964 Waiting 0.200 sec 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms
3:57.164 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms
3:57.164 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms
3:58.335 Waiting 0.800 sec 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
3:59.135 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
4:00.473 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
4:01.806 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
4:02.976 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
4:04.148 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
4:05.320 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:06.480 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala, blood_frenzy
4:07.535 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala, blood_frenzy
4:08.590 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala, blood_frenzy
4:08.590 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala, blood_frenzy
4:09.645 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala, blood_frenzy
4:10.702 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy
4:11.761 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy
4:12.818 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy
4:13.875 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy
4:13.875 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy
4:15.048 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar
4:16.302 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, howl_of_ingvar
4:16.302 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, howl_of_ingvar
4:17.554 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, howl_of_ingvar
4:18.760 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, blood_frenzy
4:19.931 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, blood_frenzy
4:21.100 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, blood_frenzy
4:22.272 Waiting 0.900 sec 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, blood_frenzy
4:23.172 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:23.172 Waiting 0.500 sec 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:23.672 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:23.672 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:24.843 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
4:25.900 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, wail_of_svala, blood_frenzy
4:26.956 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, wail_of_svala, blood_frenzy
4:28.013 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala, blood_frenzy
4:29.070 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala, blood_frenzy
4:30.126 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala, blood_frenzy
4:30.126 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala, blood_frenzy
4:31.181 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, unleash_doom, wind_strikes, gathering_storms, stormlash, wail_of_svala, blood_frenzy
4:32.237 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, wail_of_svala, blood_frenzy
4:33.336 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
4:34.563 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
4:35.815 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
4:36.987 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
4:38.158 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
4:39.331 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
4:40.503 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
4:41.674 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
4:42.845 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
4:44.017 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
4:45.187 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, crash_lightning, boulderfist, landslide, blood_frenzy
4:45.187 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, crash_lightning, boulderfist, landslide, blood_frenzy
4:46.356 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
4:47.527 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
4:48.699 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
4:49.869 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, blood_frenzy
4:49.869 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, blood_frenzy
4:51.038 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, blood_frenzy
4:52.208 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, blood_frenzy
4:53.413 Waiting 0.200 sec 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
4:53.613 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide
4:53.613 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide
4:54.784 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:55.842 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, wail_of_svala, blood_frenzy
4:56.897 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, wail_of_svala, blood_frenzy
4:57.952 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, wail_of_svala, blood_frenzy
4:59.007 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, wail_of_svala, blood_frenzy
5:00.064 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala, blood_frenzy
5:01.119 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala, blood_frenzy
5:02.176 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala, blood_frenzy
5:02.176 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala, blood_frenzy
5:03.277 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, wind_strikes, gathering_storms, stormlash, blood_frenzy
5:04.504 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
5:05.756 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash
5:07.009 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
5:08.262 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
5:09.515 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
5:10.768 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
5:12.020 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
5:13.273 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
5:14.525 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
5:15.779 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
5:17.031 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:17.031 Waiting 0.200 sec 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
5:17.231 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
5:17.231 Waiting 0.800 sec 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
5:18.031 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
5:19.434 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
5:20.603 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
5:21.774 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
5:22.945 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
5:24.117 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:25.287 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
5:26.458 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
5:27.629 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
5:28.836 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash
5:30.090 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash
5:31.342 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash
5:32.594 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
5:33.846 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, stormbringer, boulderfist, landslide, unleash_doom, dirge_of_angerboda
5:33.846 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, stormbringer, boulderfist, landslide, unleash_doom, dirge_of_angerboda
5:35.099 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, dirge_of_angerboda
5:36.352 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, stormbringer, boulderfist, landslide, wind_strikes, dirge_of_angerboda
5:37.602 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, stormbringer, boulderfist, landslide, dirge_of_angerboda
5:37.602 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, stormbringer, boulderfist, landslide, dirge_of_angerboda
5:38.856 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, boulderfist, landslide, dirge_of_angerboda
5:40.110 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide
5:41.363 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide
5:42.615 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom frostbrand, boulderfist, landslide, stormlash
5:43.857 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, wail_of_svala
5:44.980 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
5:46.104 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
5:47.226 Waiting 0.100 sec 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
5:47.326 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
5:48.693 Waiting 0.500 sec 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
5:49.193 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
5:49.193 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
5:50.315 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
5:51.437 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
5:52.923 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:54.176 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
5:55.346 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:56.516 Waiting 0.300 sec 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:56.816 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:58.238 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:59.407 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
6:00.578 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, blood_frenzy
6:01.805 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, blood_frenzy
6:02.976 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, dirge_of_angerboda, blood_frenzy
6:04.148 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, dirge_of_angerboda, blood_frenzy
6:05.397 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, dirge_of_angerboda
6:05.397 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, dirge_of_angerboda
6:06.647 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, dirge_of_angerboda
6:07.901 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar, dirge_of_angerboda
6:09.155 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar, dirge_of_angerboda
6:10.409 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, howl_of_ingvar, dirge_of_angerboda
6:11.663 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar
6:11.663 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar
6:12.916 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar
6:14.168 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar
6:15.420 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes
6:16.673 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes
6:17.925 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes
6:19.177 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
6:19.177 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom
6:20.428 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom, wind_strikes
6:21.683 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom, wind_strikes
6:21.683 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom, wind_strikes
6:22.853 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, doom_winds, unleash_doom, blood_frenzy
6:24.025 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, doom_winds, unleash_doom, blood_frenzy
6:25.195 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, blood_frenzy
6:26.366 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
6:27.536 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
6:28.703 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
6:29.873 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
6:31.042 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
6:32.251 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash
6:33.503 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms
6:34.756 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:36.009 Waiting 1.000 sec 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:37.009 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:38.464 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:38.464 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:39.717 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:40.973 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:42.225 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:43.479 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:44.732 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
6:45.985 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms
6:47.236 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms
6:48.488 Waiting 0.800 sec 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms
6:49.288 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms
6:50.540 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:51.757 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala
6:51.757 Waiting 0.100 sec 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 27088 25382 15146 (12029)
Stamina 36676 36676 21858
Intellect 7651 7326 0
Spirit 0 0 0
Health 2200560 2200560 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 32506 30458 0
Crit 26.08% 26.08% 3877
Haste 20.18% 20.18% 6557
Damage / Heal Versatility 2.74% 2.74% 1097
Attack Power 27088 25382 0
Mastery 53.38% 51.24% 6167
Armor 2618 2618 2618
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 865.00
Local Head Cave Skulker's Helm
ilevel: 870, stats: { 358 Armor, +2345 Sta, +1563 AgiInt, +1005 Haste, +401 Crit }
Local Neck Amulet of the Last Guardian
ilevel: 865, stats: { +1258 Sta, +1387 Haste, +555 Vers }, gems: { +150 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Burning Sky Pauldrons
ilevel: 850, stats: { 310 Armor, +973 AgiInt, +1459 Sta, +678 Haste, +301 Mastery }, gems: { +150 Mastery }
Local Shirt Orange Martial Shirt
ilevel: 1
Local Chest Mardum Chain Vest
ilevel: 865, stats: { 434 Armor, +1491 AgiInt, +2237 Sta, +838 Crit, +542 Vers }
Local Waist Storm Tempests
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 AgiInt, +662 Crit, +496 Haste }
Local Legs Mute Erasure Legguards
ilevel: 860, stats: { 373 Armor, +1424 AgiInt, +2136 Sta, +794 Mastery, +561 Haste }, gems: { +200 Agi }
Local Feet Gravenscale Treads of the Feverflare
ilevel: 850, stats: { 284 Armor, +1459 Sta, +973 AgiInt, +699 Haste, +279 Mastery }
Local Wrists Vilescale Bracers
ilevel: 860, stats: { 187 Armor, +801 AgiInt, +1201 Sta, +462 Crit, +299 Haste }
Local Hands Gauntlets of Confinement
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +638 Mastery, +377 Crit }
Local Finger1 Ring of Collapsing Futures
ilevel: 865, stats: { +1258 Sta, +1331 Mastery, +610 Haste, +333 Avoidance }, enchant: { +200 Mastery }
Local Finger2 Arch-Druid's Tainted Seal
ilevel: 860, stats: { +1201 Sta, +1362 Mastery, +545 Haste }, enchant: { +200 Mastery }
Local Trinket1 Memento of Angerboda
ilevel: 865, stats: { +1418 StrAgi }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }, gems: { +150 Mastery }
Local Back Cloak of Fading Echoes
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +277 Haste, +499 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 881, weapon: { 4398 - 8169, 2.6 }, stats: { +742 Agi, +1113 Sta, +319 Crit, +306 Mastery }, relics: { +43 ilevels, +43 ilevels, +45 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 881, weapon: { 4398 - 8169, 2.6 }, stats: { +742 Agi, +1113 Sta, +319 Crit, +306 Mastery }
Local Tabard Nightfallen Tabard
ilevel: 800

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Boulderfist (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Landslide (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="Bowflexn"
origin="https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/69/158226501-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=leatherworking=800/enchanting=127
talents=3313112
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:3:907:3:908:3:909:3:910:3:911:3:912:3:1351:1
spec=enhancement

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=seventh_demon
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/food,name=nightborne_delicacy_platter
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions+=/bloodlust,if=target.health.pct<25|time>0.500
actions+=/auto_attack
actions+=/feral_spirit
actions+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
actions+=/potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
actions+=/berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
actions+=/blood_fury
actions+=/crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
actions+=/crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
actions+=/windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/windstrike,if=buff.stormbringer.react
actions+=/stormstrike,if=buff.stormbringer.react
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
actions+=/flametongue,if=buff.flametongue.remains<gcd
actions+=/windsong
actions+=/ascendance
actions+=/fury_of_air,if=!ticking
actions+=/doom_winds
actions+=/crash_lightning,if=active_enemies>=3
actions+=/windstrike
actions+=/stormstrike
actions+=/lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
actions+=/lava_lash,if=buff.hot_hand.react
actions+=/earthen_spike
actions+=/crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
actions+=/flametongue,if=buff.flametongue.remains<4.8
actions+=/sundering
actions+=/lava_lash,if=maelstrom>=90
actions+=/rockbiter
actions+=/flametongue
actions+=/boulderfist

head=cave_skulkers_helm,id=141455,bonus_id=1482/3336
neck=amulet_of_the_last_guardian,id=142207,bonus_id=1808/3453/1477/3336,gems=150mastery,enchant=mark_of_the_hidden_satyr
shoulders=burning_sky_pauldrons,id=137321,bonus_id=3410/1808/1502/3336,gems=150mastery
back=cloak_of_fading_echoes,id=134405,bonus_id=3412/1517/3337,enchant=200agi
chest=mardum_chain_vest,id=134390,bonus_id=3414/1527/3336
shirt=orange_martial_shirt,id=10052
tabard=nightfallen_tabard,id=140575
wrists=vilescale_bracers,id=121316,bonus_id=3412/1522/3336
hands=gauntlets_of_confinement,id=142133,bonus_id=3453/1472
waist=storm_tempests,id=137103,bonus_id=3459/3458
legs=mute_erasure_legguards,id=134475,bonus_id=3412/1808/1512/3336,gems=200agi
feet=gravenscale_treads,id=128901,bonus_id=689/1697/3408/601/669
finger1=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1477/3336,enchant=200mastery
finger2=archdruids_tainted_seal,id=134487,bonus_id=3412/1512/3336,enchant=200mastery
trinket1=memento_of_angerboda,id=133644,bonus_id=3414/1517/3336
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1808/1472,gems=150mastery
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=136769/141268/137365/0,relic_id=1727:1502:3336/3432:1512:3337/3410:1507:3336/0
off_hand=fury_of_the_stonemother,id=128873

# Gear Summary
# gear_ilvl=865.13
# gear_agility=15146
# gear_stamina=21858
# gear_crit_rating=3877
# gear_haste_rating=6557
# gear_mastery_rating=6167
# gear_versatility_rating=1097
# gear_avoidance_rating=333
# gear_armor=2618

Alacastria

Alacastria : 274519 dps, 124300 dps to main target, 13310 dtps, 50510 hps (50510 aps), 59.6k TMI, 65.3k ETMI

  • Race: Blood Elf
  • Class: Warrior
  • Spec: Protection
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR APS APS Error APS Range APR
274519.4 274519.4 376.3 / 0.137% 68950.1 / 25.1% 57788.3 50509.6 79.66 / 0.16% 7994 / 15.8% 0.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
13309.7 28.83 / 0.22% 5774 / 43.4%       59.6k 18 / 0.03% 57.2k 64.1k 3.5k / 5.9%       17.5% 6.7% 32.6% 30.1       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
4.7 4.7 Rage 4.28% 57.6 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Alacastria/advanced
Talents
  • 15: Shockwave (Protection Warrior)
  • 30: Inspiring Presence (Protection Warrior)
  • 45: Renewed Fury (Protection Warrior)
  • 60: Crackling Thunder (Protection Warrior)
  • 75: Indomitable (Protection Warrior)
  • 90: Booming Voice (Protection Warrior)
  • 100: Heavy Repercussions (Protection Warrior)
  • Talent Calculator
Artifact
Professions
  • mining: 784
  • blacksmithing: 758
Scale Factors for Alacastria Damage Taken Per Second
Haste Vers Crit Mastery Str
Scale Factors -0.25 -0.14 -0.14 -0.11 -0.07
Normalized 3.65 2.05 1.96 1.59 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Haste > Vers ~= Crit ~= Mastery > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.07, CritRating=0.14, HasteRating=0.25, MasteryRating=0.11, Versatility=0.14 )

Scale Factors for other metrics

Scale Factors for Alacastria Damage Per Second
Str Vers Crit Mastery Haste
Scale Factors 10.85 5.96 4.92 4.90 3.33
Normalized 1.00 0.55 0.45 0.45 0.31
Scale Deltas 1138 1138 1138 1138 1138
Error 0.48 0.47 0.47 0.47 0.47
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Crit ~= Mastery > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=10.85, CritRating=4.92, HasteRating=3.33, MasteryRating=4.90, Versatility=5.96 )
Scale Factors for Alacastria Priority Target Damage Per Second
Str Vers Crit Mastery Haste
Scale Factors 4.83 2.71 2.44 2.32 1.98
Normalized 1.00 0.56 0.50 0.48 0.41
Scale Deltas 1138 1138 1138 1138 1138
Error 0.06 0.06 0.06 0.06 0.06
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=4.83, CritRating=2.44, HasteRating=1.98, MasteryRating=2.32, Versatility=2.71 )
Scale Factors for Alacastria Damage Per Second (Effective)
Str Vers Crit Mastery Haste
Scale Factors 10.85 5.96 4.92 4.90 3.33
Normalized 1.00 0.55 0.45 0.45 0.31
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=10.85, CritRating=4.92, HasteRating=3.33, MasteryRating=4.90, Versatility=5.96 )
Scale Factors for Alacastria Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Absorb Per Second
Vers Mastery Crit Str Haste
Scale Factors -0.72 -0.63 -0.38 -0.25 -0.20
Normalized 2.92 2.55 1.56 1.00 0.80
Scale Deltas 1138 1138 1138 1138 1138
Error 0.10 0.10 0.10 0.10 0.10
Gear Ranking
Optimizers
Ranking
  • Vers ~= Mastery > Crit > Str ~= Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=0.25, CritRating=0.38, HasteRating=0.20, MasteryRating=0.63, Versatility=0.72 )
Scale Factors for Healing + Absorb per second
Vers Mastery Crit Str Haste
Scale Factors -0.72 -0.63 -0.38 -0.25 -0.20
Normalized 2.92 2.55 1.56 1.00 0.80
Scale Deltas 1138 1138 1138 1138 1138
Error 0.10 0.10 0.10 0.10 0.10
Gear Ranking
Optimizers
Ranking
  • Vers ~= Mastery > Crit > Str ~= Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=0.25, CritRating=0.38, HasteRating=0.20, MasteryRating=0.63, Versatility=0.72 )
Scale Factors for Alacastria Damage Taken Per Second
Haste Vers Crit Mastery Str
Scale Factors -0.25 -0.14 -0.14 -0.11 -0.07
Normalized 3.65 2.05 1.96 1.59 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Haste > Vers ~= Crit ~= Mastery > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.07, CritRating=0.14, HasteRating=0.25, MasteryRating=0.11, Versatility=0.14 )
Scale Factors for Alacastria Damage Taken
Haste Vers Crit Mastery Str
Scale Factors -99.98 -56.10 -54.08 -42.81 -27.89
Normalized 3.58 2.01 1.94 1.53 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Vers > Crit > Mastery > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=27.89, CritRating=54.08, HasteRating=99.98, MasteryRating=42.81, Versatility=56.10 )
Scale Factors for Alacastria Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Theck-Meloree Index
Haste Crit Mastery Vers Str
Scale Factors -0.13 -0.05 -0.04 -0.02 -0.02
Normalized 5.88 2.34 1.75 1.10 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Haste > Crit ~= Mastery ~= Vers ~= Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.02, CritRating=0.05, HasteRating=0.13, MasteryRating=0.04, Versatility=0.02 )
Scale Factors for AlacastriaTheck-Meloree Index (Effective)
Haste Crit Vers Mastery Str
Scale Factors -0.11 -0.05 -0.05 -0.04 -0.02
Normalized 4.57 2.17 2.13 1.58 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Haste > Crit ~= Vers ~= Mastery ~= Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.02, CritRating=0.05, HasteRating=0.11, MasteryRating=0.04, Versatility=0.05 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
Alacastria 274519
auto_attack_mh 12881 4.7% 164.6 2.45sec 31372 14589 Direct 164.6 25488 54456 31372 20.3% 7.5%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 164.56 164.56 0.00 0.00 2.1504 0.0000 5162559.03 7763541.01 33.50 14588.90 14588.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.31 73.72% 26074.52 25054 33071 26073.22 25718 26436 3163208 4650215 31.98
hit (blocked) 9.82 5.97% 18248.99 17538 23150 18243.70 0 20256 179207 376360 52.38
crit 30.93 18.80% 55705.29 50107 66142 55762.94 53404 59377 1723035 2533025 31.98
crit (blocked) 2.49 1.51% 38958.98 35075 46299 35716.65 0 46299 97108 203941 48.03
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deep Wounds 52104 18.9% 317.5 2.19sec 65154 0 Periodic 370.2 43491 93037 55879 25.0% 0.0% 277.1%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 317.53 0.00 370.24 370.24 0.0000 3.0000 20688638.55 20688638.55 0.00 18626.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 277.7 75.00% 43491.34 41808 55187 43491.44 42894 44480 12075946 12075946 0.00
crit 92.6 25.00% 93037.28 83616 110373 93063.70 89075 96732 8612692 8612692 0.00
 
 

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc115768=Your Devastate and Revenge also cause $115767o1 Bleed damage over {$115767d=15 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.050000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Devastate 32647 12.0% 140.4 2.86sec 93612 66388 Direct 140.4 77476 164545 93612 18.5% 7.6%  

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.41 140.41 0.00 0.00 1.4101 0.0000 13144055.74 19772092.10 33.52 66388.48 66388.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.76 75.32% 79268.96 75152 99200 79266.84 77709 80642 8383536 12324591 31.98
hit (blocked) 8.63 6.14% 55495.83 52606 69440 55479.79 0 69440 478791 1005526 52.37
crit 24.04 17.12% 168390.38 150303 198400 168598.75 157553 186126 4047733 5950550 31.98
crit (blocked) 1.98 1.41% 117940.85 105212 138880 101441.70 0 138880 233996 491424 45.02
 
 

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:A direct strike, dealing ${$sw1*$<mult>} Physical damage.$?a231834[ {$s3=30}% chance to reset the remaining cooldown on Shield Slam.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Gaseous Explosion (gaseous_bubble) 27927 10.1% 7.0 60.03sec 1574580 0 Direct 31.9 200341 411783 346563 69.2% 0.0%  

Stats details: gaseous_bubble

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 31.93 0.00 0.00 0.0000 0.0000 11065522.03 11065522.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.85 30.85% 200341.30 179363 236759 200989.35 0 236759 1973202 1973202 0.00
crit 22.08 69.15% 411782.77 358725 473517 411162.69 358725 473517 9092320 9092320 0.00
 
 

Action details: gaseous_bubble

Static Values
  • id:214972
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214972
  • name:Gaseous Explosion
  • school:frost
  • tooltip:
  • description:{$@spelldesc214971=Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:137680.00
  • base_dd_max:137680.00
 
Neltharion's Fury 37572 13.6% 5.0 60.64sec 2966098 1971713 Periodic 180.0 38999 82465 82459 100.0% 0.0% 3.7%

Stats details: neltharions_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 30.03 180.03 1.5045 0.5000 14845026.78 14845026.78 0.00 658520.46 1971712.95
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.0 0.01% 38999.43 35836 39419 187.13 0 39419 932 932 0.00
crit 180.0 99.99% 82464.84 71671 94606 82465.36 78504 85146 14844095 14844095 0.00
 
 

Action details: neltharions_fury

Static Values
  • id:203524
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
Spelldata
  • id:203524
  • name:Neltharion's Fury
  • school:physical
  • tooltip:Critically blocking all incoming attacks, and dealing {$203526s1=1} Shadowflame damage to all enemies in a $203526A1 yard cone every $t2 sec.
  • description:Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: neltharions_fury_shadowflame

Static Values
  • id:203526
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203526
  • name:Neltharion's Fury
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc203524=Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.900000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Revenge 54008 19.6% 42.5 9.24sec 502865 355396 Direct 177.1 95786 202805 120787 23.4% 5.2%  

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.54 177.12 0.00 0.00 1.4150 0.0000 21394153.75 31618680.93 32.34 355396.42 355396.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.59 72.60% 96320.89 92141 121625 96311.77 93644 99875 12385739 18208209 31.98
hit (blocked) 7.16 4.04% 86180.19 64498 121625 86025.19 0 111490 616922 1013900 39.16
crit 39.26 22.17% 203795.23 184281 243251 203602.57 185597 229246 8001752 11763334 31.98
crit (blocked) 2.11 1.19% 184404.46 128997 243251 162109.77 0 243251 389741 633238 33.74
 
 

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.shield_slam.remains<=gcd.max*2
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Swing in a wide arc, dealing {$s1=1} damage to all enemies in front of you. Your successful dodges and parries reset the remaining cooldown on Revenge up to once per $5302m1 sec. |cFFFFFFFFGenerates {$/10;s2=5} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.402000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shield Slam 32640 12.0% 56.4 7.21sec 232178 164539 Direct 56.4 169686 362037 232182 32.5% 7.5%  

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.43 56.43 0.00 0.00 1.4111 0.0000 13102762.91 19704309.04 33.50 164539.36 164539.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.25 62.46% 173577.02 133471 229036 173503.37 162100 182819 6118611 8994938 31.98
hit (blocked) 2.85 5.05% 121539.78 93429 160325 114128.20 0 160325 346283 727242 49.19
crit 16.97 30.06% 370305.69 266941 458071 370718.13 333928 412573 6282599 9236016 31.98
crit (blocked) 1.37 2.43% 259535.94 186859 320650 195094.50 0 320650 355269 746113 39.35
 
 

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slams the target with your shield, causing {$s1=1} Physical damage. |cFFFFFFFFGenerates {$/10;s3=20} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:4.928000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Thunder Clap 24741 9.0% 27.2 10.86sec 360093 256364 Direct 162.9 46915 99489 60015 24.9% 0.0%  

Stats details: thunder_clap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.15 162.91 0.00 0.00 1.4046 0.0000 9776952.57 14373046.37 31.98 256363.97 256363.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.31 75.08% 46914.99 44798 59133 46912.56 45413 48811 5738352 8435921 31.98
crit 40.59 24.92% 99489.44 89596 118266 99448.46 90193 107291 4038601 5937126 31.98
 
 

Action details: thunder_clap

Static Values
  • id:6343
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.thunder_clap>=3
Spelldata
  • id:6343
  • name:Thunder Clap
  • school:physical
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Blasts all enemies within $6343A1 yards for $?s12712[${$6343m1*1.2}][$6343m1] damage{$?s199045=false}[, rooting them for {$199042d=1 second} and reducing their movement speed by {$s2=50}% for {$d=10 seconds}.][ and reduces their movement speed by {$s2=50}% for {$d=10 seconds}.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.654000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Alacastria 0
Ignore Pain 50535 100.1% 26.7 15.49sec 759788 0 Direct 237.6 85342 0 85342 0.0%  

Stats details: ignore_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 26.68 237.56 0.00 0.00 0.0000 0.0000 20273850.62 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 237.56 100.00% 85341.75 0 208371 85328.09 77484 94425 20273851 0 0.00
 
 

Action details: ignore_pain

Static Values
  • id:190456
  • school:physical
  • resource:rage
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:40.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
Spelldata
  • id:190456
  • name:Ignore Pain
  • school:physical
  • tooltip:Ignoring {$s2=90}% of the next ${$w1*10/9} total damage that you take, from any sources.
  • description:Fight through the pain, ignoring {$s2=90}% of the next up to ${($m1/10)*$AP*(1+$@versadmg)} damage you take from any sources, based on Rage spent.
 
Simple Action Stats Execute Interval
Alacastria
Arcane Torrent 4.9 90.29sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.93 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:69179
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:69179
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and increase your Rage by {$/10;s2=15}. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Battle Cry 7.1 60.72sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Demoralizing Shout 3.7 121.38sec

Stats details: demoralizing_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demoralizing_shout

Static Values
  • id:1160
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.20
Spelldata
  • id:1160
  • name:Demoralizing Shout
  • school:physical
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Intercept 20.1 20.42sec

Stats details: intercept

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.13 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: intercept

Static Values
  • id:198304
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198304
  • name:Intercept
  • school:physical
  • tooltip:
  • description:Run at high speed toward an ally or enemy. When targeting an enemy, Intercept will root for {$105771d=1.500 seconds}, but has a minimum range of {$s1=8} yds. When targeting an ally, Intercept will intercept the next melee or ranged attack against the ally within {$147833d=10 seconds} while the target remains within $147833A2 yards. |cFFFFFFFFGenerates {$/10;s2=10} Rage.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield Block 28.8 14.27sec

Stats details: shield_block

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_block

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:13.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 
Shield Block (_heavy_repercussions) 49.1 8.31sec

Stats details: shield_block_heavy_repercussions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_block_heavy_repercussions

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Cry 7.1 0.0 60.9sec 60.7sec 8.79% 8.79% 0.0(0.0) 7.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:8.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 26.61% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demoralizing Shout 3.7 0.0 121.8sec 121.4sec 7.40% 7.40% 0.0(0.0) 3.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_demoralizing_shout
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • demoralizing_shout_1:7.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Dragon Scales 13.8 0.0 28.9sec 28.9sec 24.18% 24.18% 0.0(0.0) 3.2

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_dragon_scales
  • max_stacks:1
  • duration:12.00
  • cooldown:15.00
  • default_chance:20.00%
  • default_value:0.40

Stack Uptimes

  • dragon_scales_1:24.18%

Trigger Attempt Success

  • trigger_pct:20.59%

Spelldata details

  • id:203581
  • name:Dragon Scales
  • tooltip:Your next Ignore Pain will ignore {$s1=40}% more damage.
  • description:{$@spelldesc203576=Blocking an attack has a chance to increase the total damage ignored by your next Ignore Pain by {$203581s1=40}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Gaseous Bubble 7.1 0.0 60.4sec 60.5sec 9.02% 100.00% 0.0(0.0) 1.1

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_gaseous_bubble
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:308250.00

Stack Uptimes

  • gaseous_bubble_1:9.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214971
  • name:Gaseous Bubble
  • tooltip:Absorbs $w1 damage. Causes a Gaseous Explosion when removed.
  • description:Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignore Pain 15.6 11.1 26.3sec 15.5sec 86.44% 100.00% 11.1(11.1) 14.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_ignore_pain
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:186.00

Stack Uptimes

  • ignore_pain_1:86.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190456
  • name:Ignore Pain
  • tooltip:Ignoring {$s2=90}% of the next ${$w1*10/9} total damage that you take, from any sources.
  • description:Fight through the pain, ignoring {$s2=90}% of the next up to ${($m1/10)*$AP*(1+$@versadmg)} damage you take from any sources, based on Rage spent.
  • max_stacks:0
  • duration:15.00
  • cooldown:1.00
  • default_chance:0.00%
intercept_movement 3.0 0.0 89.1sec 89.1sec 0.24% 1.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_intercept_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • intercept_movement_1:0.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Mark of the Heavy Hide 9.0 2.4 43.1sec 33.3sec 25.03% 25.03% 2.4(2.4) 8.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_mark_of_the_heavy_hide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3000.00

Stack Uptimes

  • mark_of_the_heavy_hide_1:25.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:228399
  • name:Mark of the Heavy Hide
  • tooltip:Armor increased by {$s1=3000}.
  • description:Armor increased by {$s1=3000}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Neltharion's Fury 5.0 0.0 60.6sec 60.6sec 3.80% 3.80% 30.0(30.0) 5.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_neltharions_fury
  • max_stacks:1
  • duration:3.00
  • cooldown:45.00
  • default_chance:100.00%
  • default_value:3.00

Stack Uptimes

  • neltharions_fury_1:3.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203524
  • name:Neltharion's Fury
  • tooltip:Critically blocking all incoming attacks, and dealing {$203526s1=1} Shadowflame damage to all enemies in a $203526A1 yard cone every $t2 sec.
  • description:Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.
  • max_stacks:0
  • duration:3.00
  • cooldown:45.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 13.32% 13.32% 2.0(2.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:13.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Renewed Fury 25.0 1.7 16.3sec 15.5sec 38.78% 38.78% 1.7(1.7) 24.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_renewed_fury
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • renewed_fury_1:38.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202289
  • name:Renewed Fury
  • tooltip:Damage done increased by {$s1=10}%.
  • description:{$@spelldesc202288=Ignore Pain also enrages you, increasing all damage you deal by {$202289s1=10}% for {$202289d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shield Block 28.1 0.0 14.5sec 14.5sec 60.94% 86.89% 0.0(0.0) 27.5

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_shield_block
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shield_block_1:60.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:132404
  • name:Shield Block
  • tooltip:Block chance increased by {$s1=100}%.
  • description:{$@spelldesc2565=Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Unbending Potion 2.0 0.0 319.4sec 0.0sec 11.87% 11.87% 0.0(0.0) 1.5

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_unbending_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3500.00

Stack Uptimes

  • unbending_potion_1:11.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188029
  • name:Unbending Potion
  • tooltip:Armor increased by {$s1=3500}.
  • description:Increases your Armor by {$s1=3500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Intercept0.4860.0011.2568.0674.92812.208
Shield Block2.0350.00322.32954.83428.626115.446
Ignore Pain14.2880.45234.607366.977269.381458.630
Demoralizing Shout31.8400.00133.68787.00833.486128.583
Battle Cry1.0240.0012.6165.5831.89310.112
Neltharion's Fury15.64315.00097.91962.65161.355159.450
Shield Slam1.7000.00123.26093.46545.236158.602
Revenge2.1200.00139.35987.75529.024163.077
Thunder Clap5.2650.00725.059137.684107.260172.423

Resources

Resource Usage Type Count Total Average RPE APR
Alacastria
ignore_pain Rage 26.7 1601.0 60.0 60.0 12663.1
shield_block Rage 28.8 288.3 10.0 10.0 0.0
Resource Gains Type Count Total Average Overflow
ignore_pain Health 237.56 20273814.41 (100.00%) 85341.75 0.00 0.00%
intercept Rage 20.13 201.30 (10.47%) 10.00 0.00 0.00%
arcane_torrent Rage 4.93 74.01 (3.85%) 15.00 0.00 0.00%
shield_slam Rage 56.43 1128.68 (58.71%) 20.00 0.00 0.00%
revenge Rage 42.54 212.72 (11.07%) 5.00 0.00 0.00%
booming_voice Rage 3.73 186.69 (9.71%) 50.00 0.00 0.00%
rage_from_damage_taken Rage 275.13 118.94 (6.19%) 0.43 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 0.00 13307.62
Rage 4.80 4.71
Combat End Resource Mean Min Max
Rage 32.86 0.08 81.11

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
parry_haste 19.5 19.5sec
delayed_auto_attack 13.1 27.6sec

Statistics & Data Analysis

Fight Length
Sample Data Alacastria Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Alacastria Damage Per Second
Count 9999
Mean 274519.41
Minimum 232603.46
Maximum 334244.91
Spread ( max - min ) 101641.44
Range [ ( max - min ) / 2 * 100% ] 18.51%
Standard Deviation 19198.7180
5th Percentile 246836.37
95th Percentile 308026.33
( 95th Percentile - 5th Percentile ) 61189.96
Mean Distribution
Standard Deviation 191.9968
95.00% Confidence Intervall ( 274143.10 - 274895.71 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 187
0.1% Error 18788
0.1 Scale Factor Error with Delta=300 3146502
0.05 Scale Factor Error with Delta=300 12586011
0.01 Scale Factor Error with Delta=300 314650285
Priority Target DPS
Sample Data Alacastria Priority Target Damage Per Second
Count 9999
Mean 124299.96
Minimum 114923.72
Maximum 134998.71
Spread ( max - min ) 20074.99
Range [ ( max - min ) / 2 * 100% ] 8.08%
Standard Deviation 2464.5594
5th Percentile 120323.74
95th Percentile 128410.48
( 95th Percentile - 5th Percentile ) 8086.73
Mean Distribution
Standard Deviation 24.6468
95.00% Confidence Intervall ( 124251.65 - 124348.27 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1510
0.1 Scale Factor Error with Delta=300 51851
0.05 Scale Factor Error with Delta=300 207406
0.01 Scale Factor Error with Delta=300 5185161
DPS(e)
Sample Data Alacastria Damage Per Second (Effective)
Count 9999
Mean 274519.41
Minimum 232603.46
Maximum 334244.91
Spread ( max - min ) 101641.44
Range [ ( max - min ) / 2 * 100% ] 18.51%
Damage
Sample Data Alacastria Damage
Count 9999
Mean 109179671.35
Minimum 93958063.64
Maximum 126857345.43
Spread ( max - min ) 32899281.78
Range [ ( max - min ) / 2 * 100% ] 15.07%
DTPS
Sample Data Alacastria Damage Taken Per Second
Count 9999
Mean 13309.69
Minimum 8255.53
Maximum 19689.17
Spread ( max - min ) 11433.64
Range [ ( max - min ) / 2 * 100% ] 42.95%
Standard Deviation 1470.8807
5th Percentile 10901.95
95th Percentile 15778.57
( 95th Percentile - 5th Percentile ) 4876.63
Mean Distribution
Standard Deviation 14.7095
95.00% Confidence Intervall ( 13280.86 - 13338.52 )
Normalized 95.00% Confidence Intervall ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 469
0.1% Error 46915
0.1 Scale Factor Error with Delta=300 18468
0.05 Scale Factor Error with Delta=300 73875
0.01 Scale Factor Error with Delta=300 1846879
HPS
Sample Data Alacastria Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Alacastria Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Alacastria Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Alacastria Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Alacastria Theck-Meloree Index
Count 9999
Mean 59632.25
Minimum 57190.13
Maximum 64085.14
Spread ( max - min ) 6895.01
Range [ ( max - min ) / 2 * 100% ] 5.78%
Standard Deviation 903.3333
5th Percentile 58296.14
95th Percentile 61224.51
( 95th Percentile - 5th Percentile ) 2928.37
Mean Distribution
Standard Deviation 9.0338
95.00% Confidence Intervall ( 59614.55 - 59649.96 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 881
0.1 Scale Factor Error with Delta=300 6965
0.05 Scale Factor Error with Delta=300 27863
0.01 Scale Factor Error with Delta=300 696594
ETMI
Sample Data AlacastriaTheck-Meloree Index (Effective)
Count 9999
Mean 65339.39
Minimum 63322.13
Maximum 68878.52
Spread ( max - min ) 5556.38
Range [ ( max - min ) / 2 * 100% ] 4.25%
Standard Deviation 665.7573
5th Percentile 64301.77
95th Percentile 66486.85
( 95th Percentile - 5th Percentile ) 2185.08
Mean Distribution
Standard Deviation 6.6579
95.00% Confidence Intervall ( 65326.34 - 65352.44 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 3
0.1% Error 398
0.1 Scale Factor Error with Delta=300 3783
0.05 Scale Factor Error with Delta=300 15134
0.01 Scale Factor Error with Delta=300 378369
MSD
Sample Data Alacastria Max Spike Value
Count 2504
Mean 17.52
Minimum 6.74
Maximum 32.56
Spread ( max - min ) 25.82
Range [ ( max - min ) / 2 * 100% ] 73.69%
Standard Deviation 4.0986
5th Percentile 11.40
95th Percentile 24.87
( 95th Percentile - 5th Percentile ) 13.47
Mean Distribution
Standard Deviation 0.0819
95.00% Confidence Intervall ( 17.36 - 17.68 )
Normalized 95.00% Confidence Intervall ( 99.08% - 100.92% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 2102
0.1% Error 210217
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 14

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=seedbattered_fish_plate
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=unbending_potion
Default action list Executed every time the actor is available.
# count action,conditions
5 20.13 intercept
6 14.09 auto_attack
7 7.12 use_item,name=giant_ornamental_pearl
0.00 blood_fury
0.00 berserking
8 4.93 arcane_torrent
9 0.00 call_action_list,name=prot
actions.prot
# count action,conditions
A 28.83 shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
B 26.68 ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
0.00 focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
C 0.00 demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
0.00 shield_wall,if=incoming_damage_2500ms>health.max*0.50
0.00 last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
D 1.00 potion,name=unbending_potion,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
E 0.00 call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
0.00 focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
F 2.07 battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
G 1.73 demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
0.00 ravager,if=talent.ravager.enabled&buff.battle_cry.up
H 0.00 neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
I 32.81 shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
J 15.63 revenge,if=cooldown.shield_slam.remains<=gcd.max*2
K 93.81 devastate
actions.prot_aoe
# count action,conditions
0.00 focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
L 5.00 battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
M 2.00 demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
0.00 ravager,if=talent.ravager.enabled&buff.battle_cry.up
N 5.00 neltharions_fury,if=buff.battle_cry.up
O 23.62 shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
P 26.92 revenge
Q 27.15 thunder_clap,if=spell_targets.thunder_clap>=3
R 46.61 devastate

Sample Sequence

01245678AFGBIKKKJKIKKAKI6BKIKKKJK56AOQRRPQO6BPRAOQRRPPOQR5AIBKKKJKI6RAOPBQR7R5LNOPQARRIKKKJJBK56RAOQPRR8Q6OBPRAPQRI5KIKKKAJ6OBQRRO7PQ5ALMBNRROPBKIKKAIKIPQ5BROPQARROQP6ROBQKAK5JKIKI6PBQRRRQ78AOP5LNQPROBKKAIKIK6P5BRQRRPQAORRQPJIK5BKAIKK6PQORARQ7PR5LMBNOBPQK6KAKIKKK6OP5BQRRR8AOPQRORKKBJK5AIKI6PQRRAOB6R7PQLN5POQKAIKKBKJKIKKAI5KKKJKIBKKAKJJIKI5BKKKAIKKKJKI78BKKKFGAI5BKKKIKIKKAK6IBKKIDK5KJKAIKKIBKKKJKAIK5KKI

Sample Sequence Table

time name target resources buffs
Pre flask Alacastria 0.0/130: 0% rage
Pre food Alacastria 0.0/130: 0% rage
Pre augmentation Alacastria 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage unbending_potion
0:00.000 intercept Fluffy_Pillow 0.0/130: 0% rage unbending_potion
0:00.000 auto_attack Fluffy_Pillow 10.0/130: 8% rage mark_of_the_heavy_hide, unbending_potion
0:00.000 use_item_giant_ornamental_pearl Fluffy_Pillow 10.0/130: 8% rage mark_of_the_heavy_hide, unbending_potion
0:00.000 arcane_torrent Fluffy_Pillow 10.0/130: 8% rage gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 shield_block Fluffy_Pillow 25.0/130: 19% rage gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 battle_cry Fluffy_Pillow 15.0/130: 12% rage shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 demoralizing_shout Fluffy_Pillow 15.0/130: 12% rage battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 ignore_pain Alacastria 65.0/130: 50% rage demoralizing_shout, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 shield_slam Fluffy_Pillow 5.0/130: 4% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:01.348 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:02.467 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:03.588 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:04.707 revenge Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:05.829 devastate Fluffy_Pillow 30.0/130: 23% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:06.947 shield_slam Fluffy_Pillow 30.0/130: 23% rage bloodlust, demoralizing_shout, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:08.068 devastate Fluffy_Pillow 50.2/130: 39% rage bloodlust, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
0:09.187 devastate Fluffy_Pillow 50.3/130: 39% rage bloodlust, dragon_scales, ignore_pain, mark_of_the_heavy_hide, unbending_potion
0:10.306 shield_block Fluffy_Pillow 50.3/130: 39% rage bloodlust, dragon_scales, ignore_pain, unbending_potion
0:10.306 devastate Fluffy_Pillow 40.3/130: 31% rage bloodlust, dragon_scales, ignore_pain, shield_block, unbending_potion
0:11.425 shield_slam Fluffy_Pillow 40.4/130: 31% rage bloodlust, dragon_scales, ignore_pain, shield_block, unbending_potion
0:12.544 auto_attack Fluffy_Pillow 60.5/130: 47% rage bloodlust, raid_movement, dragon_scales, ignore_pain, shield_block, unbending_potion
0:12.544 ignore_pain Alacastria 60.5/130: 47% rage bloodlust, raid_movement, dragon_scales, ignore_pain, shield_block, unbending_potion
0:12.544 devastate Fluffy_Pillow 0.5/130: 0% rage bloodlust, raid_movement, renewed_fury, ignore_pain, shield_block, unbending_potion
0:13.665 shield_slam Fluffy_Pillow 0.7/130: 1% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:14.785 devastate Fluffy_Pillow 20.7/130: 16% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:15.904 devastate Fluffy_Pillow 20.8/130: 16% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:17.022 devastate Fluffy_Pillow 21.1/130: 16% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:18.142 revenge Fluffy_Pillow 21.3/130: 16% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:19.263 devastate Fluffy_Pillow 26.4/130: 20% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:20.382 intercept Fluffy_Pillow 26.7/130: 21% rage bloodlust, raid_movement, ignore_pain, unbending_potion
0:20.382 Waiting 0.500 sec 36.7/130: 28% rage bloodlust, raid_movement, intercept_movement, ignore_pain, unbending_potion
0:20.882 auto_attack Fluffy_Pillow 36.7/130: 28% rage bloodlust, intercept_movement, ignore_pain, unbending_potion
0:20.882 shield_block Fluffy_Pillow 36.7/130: 28% rage bloodlust, intercept_movement, ignore_pain, unbending_potion
0:20.882 shield_slam Fluffy_Pillow 26.7/130: 21% rage bloodlust, intercept_movement, ignore_pain, shield_block, unbending_potion
0:22.001 thunder_clap Fluffy_Pillow 46.9/130: 36% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:23.120 devastate Fluffy_Pillow 47.1/130: 36% rage bloodlust, ignore_pain, shield_block
0:24.241 devastate Fluffy_Pillow 47.2/130: 36% rage bloodlust, dragon_scales, ignore_pain, shield_block
0:25.359 revenge Fluffy_Pillow 47.2/130: 36% rage bloodlust, dragon_scales, ignore_pain, shield_block
0:26.479 thunder_clap Fluffy_Pillow 52.4/130: 40% rage bloodlust, dragon_scales, ignore_pain, shield_block
0:27.601 shield_slam Fluffy_Pillow 52.4/130: 40% rage bloodlust, dragon_scales, shield_block
0:28.720 auto_attack Fluffy_Pillow 72.4/130: 56% rage bloodlust, raid_movement, dragon_scales, shield_block
0:28.720 ignore_pain Alacastria 72.4/130: 56% rage bloodlust, raid_movement, dragon_scales, shield_block
0:28.720 revenge Fluffy_Pillow 12.4/130: 10% rage bloodlust, raid_movement, renewed_fury, ignore_pain, shield_block
0:29.838 devastate Fluffy_Pillow 17.4/130: 13% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:30.956 shield_block Fluffy_Pillow 17.8/130: 14% rage bloodlust, renewed_fury, ignore_pain
0:30.956 shield_slam Fluffy_Pillow 7.8/130: 6% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:32.077 thunder_clap Fluffy_Pillow 28.0/130: 22% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:33.195 devastate Fluffy_Pillow 28.0/130: 22% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:34.313 devastate Fluffy_Pillow 28.3/130: 22% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:35.433 revenge Fluffy_Pillow 28.3/130: 22% rage bloodlust, ignore_pain, shield_block
0:36.552 revenge Fluffy_Pillow 33.6/130: 26% rage bloodlust, ignore_pain, shield_block
0:37.673 shield_slam Fluffy_Pillow 38.6/130: 30% rage bloodlust, ignore_pain, shield_block
0:38.792 thunder_clap Fluffy_Pillow 58.6/130: 45% rage bloodlust, ignore_pain, shield_block
0:39.912 devastate Fluffy_Pillow 58.6/130: 45% rage bloodlust, ignore_pain, shield_block
0:41.041 intercept Fluffy_Pillow 58.7/130: 45% rage ignore_pain
0:41.041 shield_block Fluffy_Pillow 68.7/130: 53% rage ignore_pain
0:41.041 shield_slam Fluffy_Pillow 58.7/130: 45% rage ignore_pain, shield_block
0:42.497 ignore_pain Alacastria 79.1/130: 61% rage ignore_pain, shield_block
0:42.497 devastate Fluffy_Pillow 19.1/130: 15% rage renewed_fury, ignore_pain, shield_block
0:43.953 devastate Fluffy_Pillow 19.1/130: 15% rage renewed_fury, ignore_pain, shield_block
0:45.407 devastate Fluffy_Pillow 19.4/130: 15% rage renewed_fury, ignore_pain, shield_block
0:46.862 revenge Fluffy_Pillow 19.5/130: 15% rage renewed_fury, ignore_pain, shield_block
0:48.317 devastate Fluffy_Pillow 24.7/130: 19% rage renewed_fury, ignore_pain, shield_block
0:49.773 shield_slam Fluffy_Pillow 24.7/130: 19% rage ignore_pain
0:51.229 Waiting 1.700 sec 45.2/130: 35% rage raid_movement, ignore_pain
0:52.929 auto_attack Fluffy_Pillow 45.6/130: 35% rage raid_movement, ignore_pain
0:52.929 devastate Fluffy_Pillow 45.6/130: 35% rage raid_movement, ignore_pain
0:54.384 shield_block Fluffy_Pillow 45.7/130: 35% rage ignore_pain
0:54.384 shield_slam Fluffy_Pillow 35.7/130: 27% rage ignore_pain, shield_block, mark_of_the_heavy_hide
0:55.840 revenge Fluffy_Pillow 55.7/130: 43% rage ignore_pain, shield_block, mark_of_the_heavy_hide
0:57.295 ignore_pain Alacastria 61.0/130: 47% rage ignore_pain, shield_block, mark_of_the_heavy_hide
0:57.295 thunder_clap Fluffy_Pillow 1.0/130: 1% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:58.752 devastate Fluffy_Pillow 1.2/130: 1% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
1:00.207 use_item_giant_ornamental_pearl Fluffy_Pillow 1.5/130: 1% rage raid_movement, renewed_fury, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:00.207 Waiting 0.300 sec 1.5/130: 1% rage raid_movement, renewed_fury, dragon_scales, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:00.507 devastate Fluffy_Pillow 1.5/130: 1% rage raid_movement, renewed_fury, dragon_scales, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:01.963 intercept Fluffy_Pillow 1.5/130: 1% rage renewed_fury, dragon_scales, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
1:01.963 battle_cry Fluffy_Pillow 11.5/130: 9% rage renewed_fury, dragon_scales, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
1:01.963 neltharions_fury Fluffy_Pillow 11.5/130: 9% rage renewed_fury, dragon_scales, ignore_pain, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
1:03.468 shield_slam Fluffy_Pillow 11.5/130: 9% rage dragon_scales, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
1:04.923 revenge Fluffy_Pillow 31.5/130: 24% rage dragon_scales, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
1:06.377 thunder_clap Fluffy_Pillow 37.0/130: 28% rage dragon_scales, ignore_pain, battle_cry, mark_of_the_heavy_hide
1:07.830 shield_block Fluffy_Pillow 37.0/130: 28% rage dragon_scales, ignore_pain, mark_of_the_heavy_hide
1:07.830 devastate Fluffy_Pillow 27.0/130: 21% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:09.284 devastate Fluffy_Pillow 27.1/130: 21% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:10.739 shield_slam Fluffy_Pillow 27.3/130: 21% rage dragon_scales, ignore_pain, shield_block
1:12.193 devastate Fluffy_Pillow 47.4/130: 36% rage ignore_pain, shield_block
1:13.647 devastate Fluffy_Pillow 47.4/130: 36% rage shield_block
1:15.101 devastate Fluffy_Pillow 48.8/130: 38% rage shield_block
1:16.557 revenge Fluffy_Pillow 52.6/130: 40% rage raid_movement
1:18.011 revenge Fluffy_Pillow 57.6/130: 44% rage
1:19.464 ignore_pain Alacastria 65.1/130: 50% rage
1:19.464 devastate Fluffy_Pillow 5.1/130: 4% rage renewed_fury, ignore_pain
1:20.917 Waiting 0.800 sec 5.5/130: 4% rage raid_movement, renewed_fury, ignore_pain
1:21.717 intercept Fluffy_Pillow 5.5/130: 4% rage raid_movement, renewed_fury, ignore_pain
1:21.963 Waiting 0.200 sec 15.5/130: 12% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
1:22.163 auto_attack Fluffy_Pillow 15.8/130: 12% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
1:22.163 devastate Fluffy_Pillow 15.8/130: 12% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
1:23.618 shield_block Fluffy_Pillow 15.8/130: 12% rage renewed_fury, ignore_pain
1:23.618 shield_slam Fluffy_Pillow 5.8/130: 4% rage renewed_fury, ignore_pain, shield_block
1:25.074 thunder_clap Fluffy_Pillow 26.0/130: 20% rage renewed_fury, dragon_scales, ignore_pain, shield_block
1:26.527 revenge Fluffy_Pillow 26.2/130: 20% rage dragon_scales, ignore_pain, shield_block
1:28.169 devastate Fluffy_Pillow 31.5/130: 24% rage dragon_scales, ignore_pain, shield_block
1:29.623 devastate Fluffy_Pillow 31.6/130: 24% rage dragon_scales, ignore_pain, shield_block
1:31.078 arcane_torrent Fluffy_Pillow 31.9/130: 25% rage dragon_scales, ignore_pain, shield_block
1:31.078 thunder_clap Fluffy_Pillow 46.9/130: 36% rage dragon_scales, ignore_pain, shield_block
1:32.532 auto_attack Fluffy_Pillow 46.9/130: 36% rage raid_movement, dragon_scales, ignore_pain
1:32.532 shield_slam Fluffy_Pillow 46.9/130: 36% rage raid_movement, dragon_scales, ignore_pain
1:33.985 ignore_pain Alacastria 67.0/130: 52% rage dragon_scales, ignore_pain
1:33.985 revenge Fluffy_Pillow 7.0/130: 5% rage renewed_fury, ignore_pain
1:35.441 devastate Fluffy_Pillow 12.9/130: 10% rage renewed_fury, ignore_pain
1:36.895 shield_block Fluffy_Pillow 12.9/130: 10% rage renewed_fury, ignore_pain
1:36.895 revenge Fluffy_Pillow 2.9/130: 2% rage renewed_fury, ignore_pain, shield_block
1:38.350 thunder_clap Fluffy_Pillow 8.2/130: 6% rage renewed_fury, ignore_pain, shield_block
1:39.803 devastate Fluffy_Pillow 8.3/130: 6% rage renewed_fury, ignore_pain, shield_block
1:41.257 shield_slam Fluffy_Pillow 8.7/130: 7% rage ignore_pain, shield_block
1:42.713 intercept Fluffy_Pillow 28.9/130: 22% rage ignore_pain, shield_block
1:42.713 devastate Fluffy_Pillow 38.9/130: 30% rage ignore_pain, shield_block
1:44.168 shield_slam Fluffy_Pillow 39.2/130: 30% rage ignore_pain, shield_block
1:45.622 devastate Fluffy_Pillow 59.4/130: 46% rage ignore_pain, shield_block
1:47.076 devastate Fluffy_Pillow 59.7/130: 46% rage ignore_pain
1:48.530 devastate Fluffy_Pillow 59.7/130: 46% rage raid_movement, ignore_pain
1:49.985 shield_block Fluffy_Pillow 59.7/130: 46% rage
1:49.985 revenge Fluffy_Pillow 49.7/130: 38% rage shield_block
1:51.439 Waiting 1.500 sec 56.3/130: 43% rage raid_movement, shield_block
1:52.939 auto_attack Fluffy_Pillow 58.9/130: 45% rage raid_movement, shield_block
1:52.939 shield_slam Fluffy_Pillow 58.9/130: 45% rage raid_movement, shield_block
1:54.393 ignore_pain Alacastria 80.2/130: 62% rage dragon_scales, shield_block
1:54.393 thunder_clap Fluffy_Pillow 20.2/130: 16% rage renewed_fury, ignore_pain, shield_block
1:55.848 devastate Fluffy_Pillow 20.2/130: 16% rage renewed_fury, ignore_pain, shield_block
1:57.303 devastate Fluffy_Pillow 20.6/130: 16% rage renewed_fury, ignore_pain, shield_block
1:58.759 shield_slam Fluffy_Pillow 20.9/130: 16% rage renewed_fury, ignore_pain
2:00.213 use_item_giant_ornamental_pearl Fluffy_Pillow 41.2/130: 32% rage renewed_fury, ignore_pain
2:00.213 revenge Fluffy_Pillow 41.2/130: 32% rage renewed_fury, ignore_pain, gaseous_bubble
2:01.668 thunder_clap Fluffy_Pillow 46.2/130: 36% rage ignore_pain, gaseous_bubble
2:03.122 intercept Fluffy_Pillow 46.2/130: 36% rage ignore_pain, gaseous_bubble
2:03.122 shield_block Fluffy_Pillow 56.2/130: 43% rage ignore_pain, gaseous_bubble
2:03.122 battle_cry Fluffy_Pillow 46.2/130: 36% rage ignore_pain, shield_block, gaseous_bubble
2:03.122 demoralizing_shout Fluffy_Pillow 46.2/130: 36% rage ignore_pain, battle_cry, shield_block, gaseous_bubble
2:03.122 ignore_pain Alacastria 96.2/130: 74% rage demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:03.122 neltharions_fury Fluffy_Pillow 36.2/130: 28% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:04.628 devastate Fluffy_Pillow 36.2/130: 28% rage raid_movement, renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, shield_block
2:06.084 devastate Fluffy_Pillow 36.4/130: 28% rage renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, shield_block
2:07.537 shield_slam Fluffy_Pillow 36.4/130: 28% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block
2:08.990 revenge Fluffy_Pillow 56.6/130: 44% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
2:10.444 ignore_pain Alacastria 61.9/130: 48% rage demoralizing_shout, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
2:10.444 devastate Fluffy_Pillow 1.9/130: 1% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block, mark_of_the_heavy_hide
2:11.900 shield_slam Fluffy_Pillow 1.9/130: 1% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:13.355 devastate Fluffy_Pillow 22.3/130: 17% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:14.809 devastate Fluffy_Pillow 22.7/130: 17% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:16.264 shield_block Fluffy_Pillow 22.9/130: 18% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:16.264 shield_slam Fluffy_Pillow 12.9/130: 10% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
2:17.717 devastate Fluffy_Pillow 32.9/130: 25% rage ignore_pain, shield_block, mark_of_the_heavy_hide
2:19.171 shield_slam Fluffy_Pillow 33.1/130: 25% rage ignore_pain, shield_block, mark_of_the_heavy_hide
2:20.626 revenge Fluffy_Pillow 53.2/130: 41% rage ignore_pain, shield_block, mark_of_the_heavy_hide
2:22.081 thunder_clap Fluffy_Pillow 58.5/130: 45% rage ignore_pain, shield_block, mark_of_the_heavy_hide
2:23.536 intercept Fluffy_Pillow 58.5/130: 45% rage ignore_pain, shield_block
2:23.536 ignore_pain Alacastria 68.5/130: 53% rage ignore_pain, shield_block
2:23.536 devastate Fluffy_Pillow 8.5/130: 7% rage renewed_fury, ignore_pain, shield_block
2:24.990 shield_slam Fluffy_Pillow 8.9/130: 7% rage renewed_fury, ignore_pain, shield_block
2:26.445 revenge Fluffy_Pillow 29.0/130: 22% rage renewed_fury, ignore_pain, shield_block
2:27.900 thunder_clap Fluffy_Pillow 34.0/130: 26% rage renewed_fury, ignore_pain
2:29.354 shield_block Fluffy_Pillow 34.3/130: 26% rage renewed_fury, ignore_pain
2:29.354 devastate Fluffy_Pillow 24.3/130: 19% rage renewed_fury, ignore_pain, shield_block
2:30.808 devastate Fluffy_Pillow 24.5/130: 19% rage dragon_scales, ignore_pain, shield_block
2:32.263 shield_slam Fluffy_Pillow 24.9/130: 19% rage dragon_scales, ignore_pain, shield_block
2:33.718 thunder_clap Fluffy_Pillow 44.9/130: 35% rage dragon_scales, ignore_pain, shield_block
2:35.172 revenge Fluffy_Pillow 45.4/130: 35% rage dragon_scales, ignore_pain, shield_block
2:36.626 auto_attack Fluffy_Pillow 50.7/130: 39% rage raid_movement, dragon_scales, ignore_pain, shield_block
2:36.626 devastate Fluffy_Pillow 50.7/130: 39% rage raid_movement, dragon_scales, ignore_pain, shield_block
2:38.081 shield_slam Fluffy_Pillow 51.1/130: 39% rage dragon_scales, ignore_pain
2:39.535 ignore_pain Alacastria 71.1/130: 55% rage dragon_scales
2:39.535 thunder_clap Fluffy_Pillow 11.1/130: 9% rage renewed_fury, ignore_pain
2:40.989 devastate Fluffy_Pillow 11.2/130: 9% rage renewed_fury, ignore_pain
2:42.444 shield_block Fluffy_Pillow 11.6/130: 9% rage renewed_fury, ignore_pain
2:42.444 devastate Fluffy_Pillow 1.6/130: 1% rage renewed_fury, ignore_pain, shield_block
2:43.897 intercept Fluffy_Pillow 1.6/130: 1% rage renewed_fury, ignore_pain, shield_block
2:43.897 revenge Fluffy_Pillow 11.6/130: 9% rage renewed_fury, ignore_pain, shield_block
2:45.352 devastate Fluffy_Pillow 16.8/130: 13% rage renewed_fury, ignore_pain, shield_block
2:46.806 shield_slam Fluffy_Pillow 16.9/130: 13% rage dragon_scales, ignore_pain, shield_block
2:48.259 devastate Fluffy_Pillow 36.9/130: 28% rage dragon_scales, ignore_pain, shield_block
2:49.713 shield_slam Fluffy_Pillow 37.1/130: 29% rage dragon_scales, ignore_pain, shield_block
2:51.168 Waiting 1.100 sec 57.4/130: 44% rage raid_movement, dragon_scales, ignore_pain, shield_block
2:52.268 auto_attack Fluffy_Pillow 57.8/130: 44% rage raid_movement, dragon_scales, ignore_pain
2:52.268 revenge Fluffy_Pillow 57.8/130: 44% rage raid_movement, dragon_scales, ignore_pain
2:53.721 ignore_pain Alacastria 62.9/130: 48% rage dragon_scales, ignore_pain
2:53.721 thunder_clap Fluffy_Pillow 2.9/130: 2% rage renewed_fury, ignore_pain
2:55.174 devastate Fluffy_Pillow 3.4/130: 3% rage renewed_fury, ignore_pain
2:56.628 devastate Fluffy_Pillow 3.7/130: 3% rage renewed_fury, ignore_pain
2:58.082 devastate Fluffy_Pillow 4.2/130: 3% rage renewed_fury, ignore_pain
2:59.536 thunder_clap Fluffy_Pillow 4.4/130: 3% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:00.988 use_item_giant_ornamental_pearl Fluffy_Pillow 4.7/130: 4% rage ignore_pain, mark_of_the_heavy_hide
3:00.988 arcane_torrent Fluffy_Pillow 4.7/130: 4% rage ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
3:01.078 shield_block Fluffy_Pillow 19.7/130: 15% rage ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
3:01.078 shield_slam Fluffy_Pillow 9.7/130: 7% rage ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide
3:02.531 revenge Fluffy_Pillow 29.7/130: 23% rage ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide
3:03.987 intercept Fluffy_Pillow 34.7/130: 27% rage ignore_pain, shield_block, mark_of_the_heavy_hide
3:03.987 battle_cry Fluffy_Pillow 44.7/130: 34% rage ignore_pain, shield_block, mark_of_the_heavy_hide
3:03.987 neltharions_fury Fluffy_Pillow 44.7/130: 34% rage ignore_pain, battle_cry, shield_block, mark_of_the_heavy_hide
3:05.492 thunder_clap Fluffy_Pillow 44.9/130: 35% rage ignore_pain, neltharions_fury, battle_cry, shield_block, mark_of_the_heavy_hide
3:06.944 revenge Fluffy_Pillow 44.9/130: 35% rage ignore_pain, neltharions_fury, battle_cry, shield_block, mark_of_the_heavy_hide
3:08.397 Waiting 0.100 sec 50.2/130: 39% rage raid_movement, ignore_pain, battle_cry, shield_block
3:08.497 devastate Fluffy_Pillow 50.2/130: 39% rage raid_movement, ignore_pain, battle_cry, shield_block
3:09.952 shield_slam Fluffy_Pillow 50.2/130: 39% rage
3:11.407 ignore_pain Alacastria 76.4/130: 59% rage
3:11.407 devastate Fluffy_Pillow 16.4/130: 13% rage renewed_fury, ignore_pain
3:12.861 devastate Fluffy_Pillow 16.8/130: 13% rage renewed_fury, ignore_pain
3:14.315 shield_block Fluffy_Pillow 17.2/130: 13% rage renewed_fury, ignore_pain
3:14.315 shield_slam Fluffy_Pillow 7.2/130: 6% rage renewed_fury, ignore_pain, shield_block
3:15.771 devastate Fluffy_Pillow 27.2/130: 21% rage renewed_fury, ignore_pain, shield_block
3:17.227 shield_slam Fluffy_Pillow 27.4/130: 21% rage renewed_fury, ignore_pain, shield_block
3:18.683 devastate Fluffy_Pillow 47.7/130: 37% rage ignore_pain, shield_block
3:20.138 Waiting 2.800 sec 48.0/130: 37% rage raid_movement, ignore_pain, shield_block
3:22.938 auto_attack Fluffy_Pillow 48.1/130: 37% rage raid_movement, ignore_pain, shield_block
3:22.938 revenge Fluffy_Pillow 48.1/130: 37% rage raid_movement, ignore_pain, shield_block
3:24.392 intercept Fluffy_Pillow 53.5/130: 41% rage raid_movement, ignore_pain
3:24.392 ignore_pain Alacastria 63.5/130: 49% rage raid_movement, intercept_movement, ignore_pain
3:24.392 Waiting 0.100 sec 3.5/130: 3% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
3:24.492 devastate Fluffy_Pillow 3.5/130: 3% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
3:25.947 thunder_clap Fluffy_Pillow 3.5/130: 3% rage renewed_fury, ignore_pain
3:27.401 devastate Fluffy_Pillow 3.8/130: 3% rage renewed_fury, ignore_pain
3:28.854 devastate Fluffy_Pillow 4.2/130: 3% rage renewed_fury, ignore_pain
3:30.308 revenge Fluffy_Pillow 4.7/130: 4% rage renewed_fury, ignore_pain
3:31.765 thunder_clap Fluffy_Pillow 9.7/130: 7% rage ignore_pain
3:33.219 shield_block Fluffy_Pillow 10.2/130: 8% rage ignore_pain
3:33.219 shield_slam Fluffy_Pillow 0.2/130: 0% rage ignore_pain, shield_block
3:34.674 devastate Fluffy_Pillow 20.6/130: 16% rage ignore_pain, shield_block
3:36.128 devastate Fluffy_Pillow 20.8/130: 16% rage ignore_pain, shield_block
3:37.583 thunder_clap Fluffy_Pillow 20.8/130: 16% rage ignore_pain, shield_block
3:39.037 revenge Fluffy_Pillow 21.2/130: 16% rage ignore_pain, shield_block
3:40.492 Waiting 0.100 sec 27.4/130: 21% rage raid_movement, shield_block
3:40.592 revenge Fluffy_Pillow 27.4/130: 21% rage raid_movement, shield_block
3:42.046 shield_slam Fluffy_Pillow 36.2/130: 28% rage
3:43.500 devastate Fluffy_Pillow 57.4/130: 44% rage
3:44.954 intercept Fluffy_Pillow 62.6/130: 48% rage
3:44.954 ignore_pain Alacastria 72.6/130: 56% rage
3:44.954 devastate Fluffy_Pillow 12.6/130: 10% rage renewed_fury, ignore_pain
3:46.408 shield_block Fluffy_Pillow 13.0/130: 10% rage renewed_fury, ignore_pain
3:46.408 shield_slam Fluffy_Pillow 3.0/130: 2% rage renewed_fury, ignore_pain, shield_block
3:47.863 devastate Fluffy_Pillow 23.0/130: 18% rage renewed_fury, ignore_pain, shield_block
3:49.318 devastate Fluffy_Pillow 23.7/130: 18% rage renewed_fury, ignore_pain, shield_block
3:50.773 Waiting 2.200 sec 23.9/130: 18% rage raid_movement, renewed_fury, dragon_scales, ignore_pain, shield_block
3:52.973 auto_attack Fluffy_Pillow 23.9/130: 18% rage raid_movement, dragon_scales, ignore_pain, shield_block
3:52.973 revenge Fluffy_Pillow 23.9/130: 18% rage raid_movement, dragon_scales, ignore_pain, shield_block
3:54.427 thunder_clap Fluffy_Pillow 29.3/130: 23% rage dragon_scales, ignore_pain
3:55.881 shield_slam Fluffy_Pillow 29.3/130: 23% rage dragon_scales, ignore_pain
3:57.334 devastate Fluffy_Pillow 49.6/130: 38% rage dragon_scales, ignore_pain
3:58.789 shield_block Fluffy_Pillow 50.0/130: 38% rage dragon_scales, ignore_pain
3:58.979 devastate Fluffy_Pillow 40.0/130: 31% rage dragon_scales, ignore_pain, shield_block
4:00.432 thunder_clap Fluffy_Pillow 41.8/130: 32% rage dragon_scales, shield_block
4:01.888 use_item_giant_ornamental_pearl Fluffy_Pillow 41.8/130: 32% rage dragon_scales, shield_block
4:01.888 revenge Fluffy_Pillow 41.8/130: 32% rage dragon_scales, shield_block, gaseous_bubble
4:03.341 devastate Fluffy_Pillow 46.8/130: 36% rage shield_block, gaseous_bubble
4:04.793 intercept Fluffy_Pillow 46.8/130: 36% rage shield_block, gaseous_bubble
4:04.954 battle_cry Fluffy_Pillow 56.8/130: 44% rage shield_block, gaseous_bubble
4:04.954 demoralizing_shout Fluffy_Pillow 56.8/130: 44% rage battle_cry, shield_block, gaseous_bubble
4:04.954 ignore_pain Alacastria 106.8/130: 82% rage demoralizing_shout, battle_cry, shield_block, gaseous_bubble
4:04.954 neltharions_fury Fluffy_Pillow 46.8/130: 36% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
4:06.459 shield_slam Fluffy_Pillow 46.8/130: 36% rage renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble
4:07.913 ignore_pain Alacastria 66.8/130: 51% rage renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble
4:07.913 revenge Fluffy_Pillow 6.8/130: 5% rage renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble
4:09.369 thunder_clap Fluffy_Pillow 11.8/130: 9% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, gaseous_bubble
4:10.824 devastate Fluffy_Pillow 12.1/130: 9% rage renewed_fury, demoralizing_shout, ignore_pain
4:12.277 Waiting 0.300 sec 12.5/130: 10% rage raid_movement, renewed_fury, demoralizing_shout, ignore_pain
4:12.577 auto_attack Fluffy_Pillow 12.5/130: 10% rage raid_movement, renewed_fury, demoralizing_shout, ignore_pain
4:12.577 devastate Fluffy_Pillow 12.5/130: 10% rage raid_movement, renewed_fury, demoralizing_shout, ignore_pain
4:14.032 shield_block Fluffy_Pillow 13.0/130: 10% rage ignore_pain
4:14.032 devastate Fluffy_Pillow 3.0/130: 2% rage ignore_pain, shield_block
4:15.486 shield_slam Fluffy_Pillow 3.1/130: 2% rage ignore_pain, shield_block
4:16.940 devastate Fluffy_Pillow 23.4/130: 18% rage ignore_pain, shield_block
4:18.394 devastate Fluffy_Pillow 23.6/130: 18% rage dragon_scales, ignore_pain, shield_block
4:19.848 devastate Fluffy_Pillow 23.8/130: 18% rage dragon_scales, ignore_pain, shield_block
4:21.302 Waiting 1.600 sec 24.1/130: 19% rage raid_movement, dragon_scales, ignore_pain, shield_block
4:22.902 auto_attack Fluffy_Pillow 24.5/130: 19% rage raid_movement, dragon_scales, ignore_pain, mark_of_the_heavy_hide
4:22.902 shield_slam Fluffy_Pillow 24.5/130: 19% rage raid_movement, dragon_scales, ignore_pain, mark_of_the_heavy_hide
4:24.356 revenge Fluffy_Pillow 46.8/130: 36% rage dragon_scales, mark_of_the_heavy_hide
4:25.809 intercept Fluffy_Pillow 55.6/130: 43% rage dragon_scales, mark_of_the_heavy_hide
4:25.809 ignore_pain Alacastria 65.6/130: 50% rage dragon_scales, mark_of_the_heavy_hide
4:25.809 thunder_clap Fluffy_Pillow 5.6/130: 4% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:27.264 devastate Fluffy_Pillow 6.0/130: 5% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:28.717 devastate Fluffy_Pillow 6.6/130: 5% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:30.171 devastate Fluffy_Pillow 6.9/130: 5% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:31.625 arcane_torrent Fluffy_Pillow 6.9/130: 5% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:31.625 shield_block Fluffy_Pillow 21.9/130: 17% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:31.625 shield_slam Fluffy_Pillow 11.9/130: 9% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
4:33.080 revenge Fluffy_Pillow 32.0/130: 25% rage ignore_pain, shield_block
4:34.534 thunder_clap Fluffy_Pillow 37.1/130: 29% rage dragon_scales, ignore_pain, shield_block
4:35.987 devastate Fluffy_Pillow 37.1/130: 29% rage dragon_scales, ignore_pain, shield_block
4:37.441 shield_slam Fluffy_Pillow 37.4/130: 29% rage dragon_scales, ignore_pain, shield_block
4:38.896 devastate Fluffy_Pillow 57.6/130: 44% rage dragon_scales, ignore_pain, shield_block
4:40.351 devastate Fluffy_Pillow 57.7/130: 44% rage dragon_scales, ignore_pain, shield_block
4:41.806 devastate Fluffy_Pillow 57.7/130: 44% rage dragon_scales
4:43.260 ignore_pain Alacastria 61.6/130: 47% rage dragon_scales
4:43.260 revenge Fluffy_Pillow 1.6/130: 1% rage renewed_fury, ignore_pain
4:44.714 devastate Fluffy_Pillow 6.8/130: 5% rage raid_movement, renewed_fury, ignore_pain
4:46.168 intercept Fluffy_Pillow 7.2/130: 6% rage renewed_fury, ignore_pain
4:46.168 shield_block Fluffy_Pillow 17.2/130: 13% rage renewed_fury, ignore_pain
4:46.168 shield_slam Fluffy_Pillow 7.2/130: 6% rage renewed_fury, ignore_pain, shield_block
4:47.623 devastate Fluffy_Pillow 27.2/130: 21% rage renewed_fury, ignore_pain, shield_block
4:49.078 shield_slam Fluffy_Pillow 27.4/130: 21% rage renewed_fury, ignore_pain, shield_block
4:50.532 Waiting 2.400 sec 47.6/130: 37% rage raid_movement, ignore_pain, shield_block
4:52.932 auto_attack Fluffy_Pillow 47.9/130: 37% rage raid_movement, dragon_scales, ignore_pain, shield_block
4:52.932 revenge Fluffy_Pillow 47.9/130: 37% rage raid_movement, dragon_scales, ignore_pain, shield_block
4:54.386 thunder_clap Fluffy_Pillow 53.1/130: 41% rage dragon_scales, ignore_pain, shield_block
4:55.840 devastate Fluffy_Pillow 53.1/130: 41% rage dragon_scales, ignore_pain
4:57.295 devastate Fluffy_Pillow 54.0/130: 42% rage dragon_scales, ignore_pain
4:58.750 shield_block Fluffy_Pillow 54.5/130: 42% rage dragon_scales
4:58.750 shield_slam Fluffy_Pillow 44.5/130: 34% rage dragon_scales, shield_block
5:00.205 ignore_pain Alacastria 68.5/130: 53% rage raid_movement, dragon_scales, shield_block
5:00.205 Waiting 0.300 sec 8.5/130: 7% rage raid_movement, renewed_fury, ignore_pain, shield_block
5:00.505 auto_attack Fluffy_Pillow 8.5/130: 7% rage raid_movement, renewed_fury, ignore_pain, shield_block
5:00.505 devastate Fluffy_Pillow 8.5/130: 7% rage raid_movement, renewed_fury, ignore_pain, shield_block
5:01.960 use_item_giant_ornamental_pearl Fluffy_Pillow 8.5/130: 7% rage renewed_fury, ignore_pain, shield_block
5:01.960 revenge Fluffy_Pillow 8.5/130: 7% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
5:03.416 thunder_clap Fluffy_Pillow 13.5/130: 10% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
5:04.870 battle_cry Fluffy_Pillow 13.6/130: 10% rage renewed_fury, ignore_pain, shield_block
5:04.954 neltharions_fury Fluffy_Pillow 13.6/130: 10% rage renewed_fury, ignore_pain, battle_cry, shield_block
5:06.459 intercept Fluffy_Pillow 13.9/130: 11% rage ignore_pain, neltharions_fury, battle_cry
5:06.459 revenge Fluffy_Pillow 23.9/130: 18% rage ignore_pain, neltharions_fury, battle_cry
5:07.914 shield_slam Fluffy_Pillow 28.9/130: 22% rage ignore_pain, neltharions_fury, battle_cry
5:09.369 thunder_clap Fluffy_Pillow 49.3/130: 38% rage ignore_pain, battle_cry
5:10.824 devastate Fluffy_Pillow 49.4/130: 38% rage ignore_pain
5:12.277 shield_block Fluffy_Pillow 49.7/130: 38% rage ignore_pain
5:12.277 shield_slam Fluffy_Pillow 39.7/130: 31% rage ignore_pain, shield_block
5:13.732 devastate Fluffy_Pillow 59.7/130: 46% rage ignore_pain, shield_block
5:15.186 devastate Fluffy_Pillow 59.7/130: 46% rage ignore_pain, shield_block
5:16.641 ignore_pain Alacastria 61.1/130: 47% rage raid_movement, shield_block
5:16.641 devastate Fluffy_Pillow 1.1/130: 1% rage raid_movement, renewed_fury, ignore_pain, shield_block
5:18.095 revenge Fluffy_Pillow 1.4/130: 1% rage renewed_fury, ignore_pain, shield_block
5:19.549 devastate Fluffy_Pillow 6.4/130: 5% rage renewed_fury, ignore_pain, shield_block
5:21.003 shield_slam Fluffy_Pillow 6.5/130: 5% rage renewed_fury, ignore_pain
5:22.457 devastate Fluffy_Pillow 26.8/130: 21% rage renewed_fury, ignore_pain
5:23.911 devastate Fluffy_Pillow 26.8/130: 21% rage ignore_pain
5:25.366 shield_block Fluffy_Pillow 27.1/130: 21% rage ignore_pain
5:25.366 shield_slam Fluffy_Pillow 17.1/130: 13% rage ignore_pain, shield_block
5:26.822 intercept Fluffy_Pillow 37.6/130: 29% rage ignore_pain, shield_block
5:26.822 devastate Fluffy_Pillow 47.6/130: 37% rage ignore_pain, shield_block
5:28.279 devastate Fluffy_Pillow 47.8/130: 37% rage ignore_pain, shield_block
5:29.734 devastate Fluffy_Pillow 47.8/130: 37% rage ignore_pain, shield_block
5:31.188 revenge Fluffy_Pillow 48.0/130: 37% rage ignore_pain, shield_block
5:32.642 devastate Fluffy_Pillow 55.3/130: 43% rage raid_movement, dragon_scales, shield_block
5:34.097 shield_slam Fluffy_Pillow 59.0/130: 45% rage dragon_scales
5:35.551 ignore_pain Alacastria 80.2/130: 62% rage dragon_scales
5:35.551 devastate Fluffy_Pillow 20.2/130: 16% rage renewed_fury, ignore_pain
5:37.005 devastate Fluffy_Pillow 20.6/130: 16% rage renewed_fury, ignore_pain
5:38.459 shield_block Fluffy_Pillow 21.1/130: 16% rage renewed_fury, ignore_pain
5:38.459 devastate Fluffy_Pillow 11.1/130: 9% rage renewed_fury, ignore_pain, shield_block
5:39.913 revenge Fluffy_Pillow 11.5/130: 9% rage renewed_fury, ignore_pain, shield_block
5:41.368 revenge Fluffy_Pillow 16.6/130: 13% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
5:42.824 shield_slam Fluffy_Pillow 21.7/130: 17% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:44.277 devastate Fluffy_Pillow 42.0/130: 32% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:45.732 shield_slam Fluffy_Pillow 42.2/130: 32% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:47.186 intercept Fluffy_Pillow 62.5/130: 48% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:47.186 ignore_pain Alacastria 72.5/130: 56% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:47.186 devastate Fluffy_Pillow 12.5/130: 10% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
5:48.640 devastate Fluffy_Pillow 12.7/130: 10% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
5:50.096 devastate Fluffy_Pillow 13.0/130: 10% rage renewed_fury, ignore_pain
5:51.553 shield_block Fluffy_Pillow 13.1/130: 10% rage renewed_fury, ignore_pain
5:51.553 shield_slam Fluffy_Pillow 3.1/130: 2% rage renewed_fury, ignore_pain, shield_block
5:53.009 devastate Fluffy_Pillow 23.2/130: 18% rage renewed_fury, ignore_pain, shield_block
5:54.464 devastate Fluffy_Pillow 23.4/130: 18% rage ignore_pain, shield_block
5:55.917 devastate Fluffy_Pillow 23.7/130: 18% rage ignore_pain, shield_block
5:57.371 revenge Fluffy_Pillow 23.9/130: 18% rage ignore_pain, shield_block
5:58.826 devastate Fluffy_Pillow 29.1/130: 22% rage ignore_pain, shield_block
6:00.281 shield_slam Fluffy_Pillow 29.4/130: 23% rage ignore_pain
6:01.735 use_item_giant_ornamental_pearl Fluffy_Pillow 49.4/130: 38% rage ignore_pain
6:01.960 arcane_torrent Fluffy_Pillow 49.4/130: 38% rage ignore_pain, gaseous_bubble
6:01.960 ignore_pain Alacastria 64.4/130: 50% rage ignore_pain, gaseous_bubble
6:01.960 devastate Fluffy_Pillow 4.4/130: 3% rage renewed_fury, ignore_pain, gaseous_bubble
6:03.413 devastate Fluffy_Pillow 4.4/130: 3% rage renewed_fury, ignore_pain, gaseous_bubble
6:04.867 devastate Fluffy_Pillow 4.4/130: 3% rage raid_movement, renewed_fury, ignore_pain, gaseous_bubble
6:06.323 battle_cry Fluffy_Pillow 4.4/130: 3% rage renewed_fury, dragon_scales, ignore_pain, gaseous_bubble
6:06.323 demoralizing_shout Fluffy_Pillow 4.4/130: 3% rage renewed_fury, dragon_scales, ignore_pain, battle_cry, gaseous_bubble
6:06.323 shield_block Fluffy_Pillow 54.4/130: 42% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, battle_cry, gaseous_bubble
6:06.323 shield_slam Fluffy_Pillow 44.4/130: 34% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble
6:07.779 intercept Fluffy_Pillow 64.4/130: 50% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble
6:07.779 ignore_pain Alacastria 74.4/130: 57% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble
6:07.779 devastate Fluffy_Pillow 14.4/130: 11% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
6:09.232 devastate Fluffy_Pillow 14.5/130: 11% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block
6:10.687 devastate Fluffy_Pillow 14.6/130: 11% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block
6:12.142 shield_slam Fluffy_Pillow 14.8/130: 11% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
6:13.598 devastate Fluffy_Pillow 34.8/130: 27% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
6:15.051 shield_slam Fluffy_Pillow 35.0/130: 27% rage ignore_pain, shield_block
6:16.505 devastate Fluffy_Pillow 55.7/130: 43% rage ignore_pain, shield_block
6:17.960 devastate Fluffy_Pillow 55.7/130: 43% rage ignore_pain
6:19.413 shield_block Fluffy_Pillow 56.2/130: 43% rage ignore_pain
6:19.413 devastate Fluffy_Pillow 46.2/130: 36% rage ignore_pain, shield_block
6:20.867 auto_attack Fluffy_Pillow 46.5/130: 36% rage raid_movement, ignore_pain, shield_block
6:20.867 shield_slam Fluffy_Pillow 46.5/130: 36% rage raid_movement, ignore_pain, shield_block
6:22.320 ignore_pain Alacastria 66.7/130: 51% rage ignore_pain, shield_block
6:22.320 devastate Fluffy_Pillow 6.7/130: 5% rage renewed_fury, ignore_pain, shield_block
6:23.774 devastate Fluffy_Pillow 6.7/130: 5% rage renewed_fury, ignore_pain, shield_block
6:25.228 shield_slam Fluffy_Pillow 7.3/130: 6% rage renewed_fury, ignore_pain, shield_block
6:26.682 potion Fluffy_Pillow 27.6/130: 21% rage renewed_fury, dragon_scales, ignore_pain, shield_block
6:26.682 devastate Fluffy_Pillow 27.6/130: 21% rage renewed_fury, dragon_scales, ignore_pain, shield_block, unbending_potion
6:28.136 intercept Fluffy_Pillow 27.7/130: 21% rage renewed_fury, dragon_scales, ignore_pain, shield_block, unbending_potion
6:28.136 devastate Fluffy_Pillow 37.7/130: 29% rage renewed_fury, dragon_scales, ignore_pain, shield_block, unbending_potion
6:29.591 revenge Fluffy_Pillow 37.9/130: 29% rage dragon_scales, ignore_pain, unbending_potion
6:31.045 devastate Fluffy_Pillow 43.3/130: 33% rage dragon_scales, ignore_pain, unbending_potion
6:32.499 shield_block Fluffy_Pillow 43.7/130: 34% rage dragon_scales, ignore_pain, unbending_potion
6:32.499 shield_slam Fluffy_Pillow 33.7/130: 26% rage dragon_scales, ignore_pain, shield_block, unbending_potion
6:33.954 devastate Fluffy_Pillow 53.7/130: 41% rage dragon_scales, ignore_pain, shield_block, unbending_potion
6:35.407 devastate Fluffy_Pillow 53.8/130: 41% rage dragon_scales, ignore_pain, shield_block, unbending_potion
6:36.860 shield_slam Fluffy_Pillow 54.0/130: 42% rage raid_movement, dragon_scales, ignore_pain, shield_block, unbending_potion
6:38.314 ignore_pain Alacastria 75.1/130: 58% rage shield_block, unbending_potion
6:38.314 devastate Fluffy_Pillow 15.1/130: 12% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:39.768 devastate Fluffy_Pillow 15.1/130: 12% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:41.221 devastate Fluffy_Pillow 15.1/130: 12% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:42.674 revenge Fluffy_Pillow 15.1/130: 12% rage renewed_fury, ignore_pain, unbending_potion
6:44.127 devastate Fluffy_Pillow 20.3/130: 16% rage renewed_fury, ignore_pain, unbending_potion
6:45.581 shield_block Fluffy_Pillow 20.3/130: 16% rage ignore_pain, unbending_potion
6:45.581 shield_slam Fluffy_Pillow 10.3/130: 8% rage ignore_pain, shield_block, unbending_potion
6:47.036 devastate Fluffy_Pillow 30.5/130: 23% rage dragon_scales, ignore_pain, shield_block, unbending_potion
6:48.492 intercept Fluffy_Pillow 30.6/130: 24% rage dragon_scales, ignore_pain, shield_block, unbending_potion
6:48.492 devastate Fluffy_Pillow 40.6/130: 31% rage dragon_scales, ignore_pain, shield_block, unbending_potion
6:49.946 devastate Fluffy_Pillow 40.6/130: 31% rage dragon_scales, ignore_pain, shield_block, unbending_potion
6:51.400 shield_slam Fluffy_Pillow 40.7/130: 31% rage dragon_scales, ignore_pain, shield_block, unbending_potion

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 22715 21090 10861 (8941)
Agility 6579 6254 0
Stamina 41306 41306 19030
Intellect 5328 5003 0
Spirit 2 2 0
Health 2478360 2478360 0
Rage 130 130 0
Crit 12.08% 12.08% 2129
Haste 3.41% 3.41% 1107
Damage / Heal Versatility 15.80% 14.86% 5945
Mitigation Versatility 7.90% 7.43% 5945
Attack Power 30563 28377 0
Mastery 51.83% 51.83% 9292
Armor 4256 4256 4015
Run Speed 7 0 0
Leech 2.39% 2.39% 549
Avoidance 0 0 404
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 17.05% 15.94% 2129
Tank-Block 30.56% 30.56% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 850.00
Local Head Subterranean Horror Faceguard
ilevel: 845, stats: { 548 Armor, +1238 StrInt, +1857 Sta, +777 Mastery, +503 Haste, +549 Leech }
Local Neck Krakentooth Necklace
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Vers }, enchant: mark_of_the_heavy_hide
Local Shoulders Wardbreaker Pauldrons
ilevel: 845, stats: { 506 Armor, +929 StrInt, +1393 Sta, +625 Vers, +336 Mastery }, gems: { +200 Str }
Local Chest Demonsteel Breastplate of the Harmonious
ilevel: 845, stats: { 675 Armor, +1857 Sta, +1238 StrInt, +549 Mastery, +732 Vers }
Local Waist Greatbelt of Disruption
ilevel: 850, stats: { 384 Armor, +973 StrInt, +1459 Sta, +594 Vers, +385 Mastery }
Local Legs Arcane Defender's Pants
ilevel: 840, stats: { 584 Armor, +1182 StrInt, +1773 Sta, +899 Mastery, +359 Haste }
Local Feet Leadfoot Earthshakers
ilevel: 845, stats: { 464 Armor, +929 StrInt, +1393 Sta, +666 Mastery, +295 Vers }
Local Wrists Dragonbone Wristclamps
ilevel: 855, stats: { 302 Armor, +1147 Sta, +765 StrInt, +502 Mastery, +245 Haste }
Local Hands Coralplate Gauntlets
ilevel: 840, stats: { 417 Armor, +886 StrInt, +1329 Sta, +613 Mastery, +330 Vers }
Local Finger1 Braided Silver Ring
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Vers }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Finger2 Loop of Eightfold Eyes
ilevel: 845, stats: { +1045 Sta, +1236 Mastery, +566 Vers }, enchant: { +200 Vers }
Local Trinket1 Giant Ornamental Pearl
ilevel: 850, stats: { +932 Vers }
Local Trinket2 Writhing Heart of Darkness
ilevel: 840, stats: { +404 Avoidance, +898 Crit }
Local Back Drape of the Mana-Starved
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Vers }, enchant: { +200 Str }
Local Main Hand Scaleshard
ilevel: 868, weapon: { 3897 - 7239, 2.6 }, stats: { +657 Str, +986 Sta, +304 Crit, +292 Mastery }
Local Off Hand Scale of the Earth-Warder
ilevel: 868, stats: { +863 Str, +1295 Sta, +399 Crit, +383 Mastery }, relics: { +40 ilevels, +42 ilevels, +36 ilevels }

Talents

Level
15 Shockwave (Protection Warrior) Storm Bolt (Protection Warrior) Warbringer (Protection Warrior)
30 Impending Victory (Protection Warrior) Inspiring Presence (Protection Warrior) Safeguard (Protection Warrior)
45 Renewed Fury (Protection Warrior) Ultimatum (Protection Warrior) Avatar
60 Warlord's Challenge (Protection Warrior) Bounding Stride Crackling Thunder (Protection Warrior)
75 Best Served Cold (Protection Warrior) Never Surrender (Protection Warrior) Indomitable (Protection Warrior)
90 Vengeance (Protection Warrior) Into the Fray (Protection Warrior) Booming Voice (Protection Warrior)
100 Anger Management Heavy Repercussions (Protection Warrior) Ravager (Protection Warrior)

Profile

warrior="Alacastria"
origin="https://us.api.battle.net/wow/character/thrall/Alacastria/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/45/155500077-avatar.jpg"
level=110
race=blood_elf
role=tank
position=front
professions=blacksmithing=758/mining=784
talents=1213332
artifact=11:0:0:0:0:91:1:93:1:95:3:98:2:99:1:100:3:101:3:102:3:103:1:104:1:1358:1
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=seedbattered_fish_plate
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=unbending_potion

# Executed every time the actor is available.
actions=intercept
actions+=/auto_attack
actions+=/use_item,name=giant_ornamental_pearl
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/call_action_list,name=prot

actions.prot=shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
actions.prot+=/ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
actions.prot+=/focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
actions.prot+=/demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
actions.prot+=/shield_wall,if=incoming_damage_2500ms>health.max*0.50
actions.prot+=/last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
actions.prot+=/potion,name=unbending_potion,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
actions.prot+=/call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
actions.prot+=/focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot+=/neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
actions.prot+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot+=/revenge,if=cooldown.shield_slam.remains<=gcd.max*2
actions.prot+=/devastate

actions.prot_aoe=focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot_aoe+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot_aoe+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot_aoe+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot_aoe+=/neltharions_fury,if=buff.battle_cry.up
actions.prot_aoe+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot_aoe+=/revenge
actions.prot_aoe+=/thunder_clap,if=spell_targets.thunder_clap>=3
actions.prot_aoe+=/devastate

head=subterranean_horror_faceguard,id=134511,bonus_id=1727/41/1497/3336
neck=krakentooth_necklace,id=141473,bonus_id=1472,enchant=mark_of_the_heavy_hide
shoulders=wardbreaker_pauldrons,id=136730,bonus_id=1727/1808/1507/3336,gems=200str
back=drape_of_the_manastarved,id=141543,bonus_id=1472,enchant=200str
chest=demonsteel_breastplate,id=123910,bonus_id=689/1715/3408/601/668
wrists=dragonbone_wristclamps,id=138218,bonus_id=1807/1477/3336
hands=coralplate_gauntlets,id=134224,bonus_id=3397/1502/3336
waist=greatbelt_of_disruption,id=137310,bonus_id=3410/1502/3336
legs=arcane_defenders_pants,id=134271,bonus_id=1727/1502/1813
feet=leadfoot_earthshakers,id=134507,bonus_id=1727/1497/3336
finger1=braided_silver_ring,id=134539,bonus_id=3412/1808/1502/1813,gems=150mastery,enchant=200mastery
finger2=loop_of_eightfold_eyes,id=134527,bonus_id=1726/1497/3337,enchant=200vers
trinket1=giant_ornamental_pearl,id=137369,bonus_id=3413/1502/1813
trinket2=writhing_heart_of_darkness,id=137315,bonus_id=1727/40/1492/1813
main_hand=scaleshard,id=128288
off_hand=scale_of_the_earthwarder,id=128289,bonus_id=752,gem_id=136778/137412/137546/0,relic_id=1727:1492:1813/1727:1497:3336/1726:1477/0

# Gear Summary
# gear_ilvl=850.38
# gear_strength=10861
# gear_stamina=19030
# gear_crit_rating=2129
# gear_haste_rating=1107
# gear_mastery_rating=9292
# gear_versatility_rating=5945
# gear_leech_rating=549
# gear_avoidance_rating=404
# gear_armor=4015

Simulation & Raid Information

Iterations: 10003
Threads: 4
Confidence: 95.00%
Fight Length: 309 - 493 ( 400.9 )

Performance:

Total Events Processed: 944669939
Max Event Queue: 533
Sim Seconds: 4010121
CPU Seconds: 1033.7813
Physical Seconds: 270.5430
Speed Up: 3879

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Mortwraith Mortwraith annihilation 201427 6733600 16797 5.19 133432 290786 17.3 34.7 38.6% 0.0% 0.0% 0.0% 16.93sec 6733600 400.89sec
Mortwraith Mortwraith augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Mortwraith Mortwraith auto_attack_mh 0 3245900 8097 19.66 20662 41321 131.4 131.4 38.6% 19.0% 0.0% 0.0% 3.05sec 4771780 400.89sec
Mortwraith Mortwraith auto_attack_oh 1 1622446 4047 19.66 10330 20659 131.4 131.4 38.6% 19.0% 0.0% 0.0% 3.05sec 2385149 400.89sec
Mortwraith Mortwraith blade_dance 188499 18620071 46447 62.69 32068 64178 18.3 418.8 38.6% 0.0% 0.0% 0.0% 15.63sec 27373268 400.89sec
Mortwraith Mortwraith blur 198589 0 0 0.00 0 0 0.1 0.0 0.0% 0.0% 0.0% 0.0% 177.53sec 0 400.89sec
Mortwraith Mortwraith chaos_strike 162794 22868902 57045 23.17 101547 221369 77.4 154.8 38.5% 0.0% 0.0% 0.0% 4.75sec 22868902 400.89sec
Mortwraith Mortwraith consume_magic 183752 0 0 0.00 0 0 12.6 0.0 0.0% 0.0% 0.0% 0.0% 32.56sec 0 400.89sec
Mortwraith Mortwraith death_sweep 210152 8405493 20967 18.69 48531 97054 5.4 124.9 38.7% 0.0% 0.0% 0.0% 56.88sec 12356871 400.89sec
Mortwraith Mortwraith demons_bite 162243 6504531 16225 13.31 52771 105545 89.0 89.0 38.6% 0.0% 0.0% 0.0% 4.45sec 9562277 400.89sec
Mortwraith Mortwraith eye_beam ticks -198013 27618496 69046 16.76 0 49275 11.8 111.7 100.0% 0.0% 0.0% 0.0% 32.85sec 27618496 400.89sec
Mortwraith Mortwraith anguish 202446 11628431 29006 8.67 144773 289730 0.0 57.9 38.6% 0.0% 0.0% 0.0% 0.00sec 11628431 400.89sec
Mortwraith Mortwraith fel_barrage 211053 19548218 48762 23.81 88645 177319 10.1 159.1 38.6% 0.0% 0.0% 0.0% 41.49sec 19548218 400.89sec
Mortwraith Mortwraith fel_rush 195072 21802989 54386 17.84 131979 263950 34.4 119.2 38.6% 0.0% 0.0% 0.0% 11.83sec 21802989 400.89sec
Mortwraith Mortwraith flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Mortwraith Mortwraith food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Mortwraith Mortwraith fury_of_the_illidari ticks -201467 18562050 46405 7.41 29878 59760 7.1 49.4 38.6% 0.0% 0.0% 0.0% 60.48sec 18562050 400.89sec
Mortwraith Mortwraith rage_of_the_illidari 217070 11128404 27759 4.77 349148 0 7.0 31.9 0.0% 0.0% 0.0% 0.0% 60.48sec 11128404 400.89sec
Mortwraith Mortwraith metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 241.78sec 0 400.89sec
Mortwraith Mortwraith metamorphosis_impact 200166 734482 1832 1.05 75715 151366 2.0 7.0 38.7% 0.0% 0.0% 0.0% 241.78sec 734482 400.89sec
Mortwraith Mortwraith potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Mortwraith Mortwraith potion_of_the_old_war 188028 4983688 12432 3.72 144694 289247 24.8 24.8 38.8% 0.0% 0.0% 0.0% 11.65sec 7326493 400.89sec
Mortwraith Mortwraith throw_glaive 185123 16995152 42393 16.24 113028 226031 47.9 108.5 38.6% 0.0% 0.0% 0.0% 8.41sec 24984483 400.89sec
Mortwraith Mortwraith bloodlet ticks -207690 20906437 52266 52.81 59376 0 0.0 352.1 0.0% 0.0% 0.0% 0.0% 0.00sec 20906437 400.89sec
Mortwraith Mortwraith vengeful_retreat 198793 2139480 5337 13.29 17384 34767 25.5 88.8 38.6% 0.0% 0.0% 0.0% 15.89sec 3145238 400.89sec
Táunks Táunks annihilation 201427 6558575 16360 5.62 114994 257587 18.8 37.6 41.8% 0.0% 0.0% 0.0% 16.10sec 6558575 400.89sec
Táunks Táunks augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Táunks Táunks auto_attack_mh 0 3222891 8039 21.07 18633 37267 140.8 140.8 41.9% 19.0% 0.0% 0.0% 2.84sec 4737955 400.89sec
Táunks Táunks auto_attack_oh 1 1613294 4024 21.07 9317 18632 140.8 140.8 42.0% 19.0% 0.0% 0.0% 2.84sec 2371695 400.89sec
Táunks Táunks blade_dance 188499 18581801 46351 65.83 29755 59573 19.2 439.8 41.9% 0.0% 0.0% 0.0% 14.90sec 27317007 400.89sec
Táunks Táunks blur 198589 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.03sec 0 400.89sec
Táunks Táunks chaos_strike 162794 21811571 54408 24.15 88945 199255 80.7 161.3 41.9% 0.0% 0.0% 0.0% 4.52sec 21811571 400.89sec
Táunks Táunks consume_magic 183752 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 30.86sec 0 400.89sec
Táunks Táunks death_sweep 210152 6843408 17070 16.52 43715 87310 4.9 110.4 41.9% 0.0% 0.0% 0.0% 64.25sec 10060458 400.89sec
Táunks Táunks demon_blades 203796 6148910 15338 25.26 25655 51315 168.8 168.8 42.0% 0.0% 0.0% 0.0% 5.86sec 6148910 400.89sec
Táunks Táunks eye_beam ticks -198013 14471400 36179 10.75 0 45042 7.4 71.7 100.0% 0.0% 0.0% 0.0% 54.07sec 14471400 400.89sec
Táunks Táunks anguish 202446 5902445 14723 4.71 132325 264554 0.0 31.5 41.9% 0.0% 0.0% 0.0% 0.00sec 5902445 400.89sec
Táunks Táunks fel_barrage 211053 16189633 40384 21.71 78657 157268 9.4 145.1 41.9% 0.0% 0.0% 0.0% 44.88sec 16189633 400.89sec
Táunks Táunks fel_rush 195072 27273900 68033 24.11 119296 238591 42.5 161.1 41.9% 0.0% 0.0% 0.0% 9.51sec 27273900 400.89sec
Táunks Táunks flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Táunks Táunks food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Táunks Táunks fury_of_the_illidari ticks -201467 16817851 42045 7.42 26450 52883 7.1 49.5 41.9% 0.0% 0.0% 0.0% 60.40sec 16817851 400.89sec
Táunks Táunks inner_demons 202388 5899460 14716 2.74 227025 453830 7.0 18.3 41.9% 0.0% 0.0% 0.0% 52.01sec 5899460 400.89sec
Táunks Táunks metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 242.35sec 0 400.89sec
Táunks Táunks metamorphosis_impact 200166 637223 1590 0.99 68193 136318 2.0 6.6 41.9% 0.0% 0.0% 0.0% 242.35sec 637223 400.89sec
Táunks Táunks potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Táunks Táunks potion_of_the_old_war 188028 4373098 10908 3.48 132289 264711 23.3 23.3 42.0% 0.0% 0.0% 0.0% 12.64sec 6428868 400.89sec
Táunks Táunks throw_glaive 185123 16310364 40685 17.01 101161 202326 50.0 113.7 41.8% 0.0% 0.0% 0.0% 8.04sec 23977781 400.89sec
Táunks Táunks bloodlet ticks -207690 20054316 50136 54.02 55688 0 0.0 360.1 0.0% 0.0% 0.0% 0.0% 0.00sec 20054316 400.89sec
Táunks Táunks vengeful_retreat 198793 1253326 3126 8.36 15812 31624 15.9 55.8 42.0% 0.0% 0.0% 0.0% 25.82sec 1842508 400.89sec
Illistan Illistan augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Illistan Illistan auto_attack_mh 0 3915816 9768 22.14 21362 42726 147.9 147.9 42.9% 19.0% 0.0% 6.1% 2.72sec 5889206 400.89sec
Illistan Illistan auto_attack_oh 1 1834032 4575 20.75 10680 21365 138.6 138.6 42.9% 19.0% 0.0% 6.1% 2.90sec 2758206 400.89sec
Illistan Illistan consume_soul_lesser 203794 0 0 0.00 0 0 64.4 0.0 0.0% 0.0% 0.0% 0.0% 6.14sec 0 400.89sec
Illistan Illistan demon_spikes 203720 0 0 0.00 0 0 36.1 0.0 0.0% 0.0% 0.0% 0.0% 11.17sec 0 400.89sec
Illistan Illistan empower_wards 218256 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 36.89sec 0 400.89sec
Illistan Illistan felblade 232893 4942359 12328 6.03 85820 171646 40.3 40.3 43.0% 0.0% 0.0% 7.5% 10.00sec 4942359 400.89sec
Illistan Illistan fiery_brand 204021 2254948 5625 1.06 223227 446453 7.1 7.1 42.6% 0.0% 0.0% 0.0% 60.61sec 2254948 400.89sec
Illistan Illistan flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Illistan Illistan food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Illistan Illistan immolation_aura 178740 29772977 74267 104.31 29894 59783 29.2 696.9 42.9% 0.0% 0.0% 0.0% 13.92sec 29772977 400.89sec
Illistan Illistan infernal_strike 189110 10307173 25711 10.71 100871 201746 21.3 71.6 42.7% 0.0% 0.0% 0.0% 20.10sec 10307173 400.89sec
Illistan Illistan potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Illistan Illistan shear 203782 13194586 32913 23.42 59021 118025 156.5 156.5 42.9% 0.0% 0.0% 7.5% 2.54sec 19845704 400.89sec
Illistan Illistan sigil_of_flame 204596 2638564 6582 5.24 52733 105470 13.3 35.0 42.8% 0.0% 0.0% 0.0% 31.01sec 4494341 400.89sec
Illistan Illistan sigil_of_flame ticks -204596 1855777 4639 10.41 18707 37413 13.3 69.4 42.9% 0.0% 0.0% 0.0% 31.01sec 4494341 400.89sec
Illistan Illistan soul_carver 207407 2215027 5525 2.12 109684 219593 7.1 14.2 42.6% 0.0% 0.0% 7.4% 60.64sec 3760356 400.89sec
Illistan Illistan soul_carver ticks -207407 1545329 3863 3.17 51157 102315 7.1 21.1 43.0% 0.0% 0.0% 0.0% 60.64sec 3760356 400.89sec
Illistan Illistan soul_cleave 228477 7479719 18658 6.64 117958 235886 44.4 44.4 42.9% 0.0% 0.0% 7.5% 8.99sec 11249746 400.89sec
Illistan Illistan soul_cleave_heal 228477 0 0 0.00 0 0 44.4 0.0 0.0% 0.0% 0.0% 0.0% 8.99sec 0 400.89sec
Buuey Buuey augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Buuey Buuey blessing_of_elune 202737 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Buuey Buuey celestial_alignment 194223 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 192.93sec 0 400.89sec
Buuey Buuey deadly_grace 188091 3213044 8015 3.85 105559 215481 25.9 25.7 17.6% 0.0% 0.0% 0.0% 8.82sec 3213044 400.89sec
Buuey Buuey flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Buuey Buuey food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Buuey Buuey full_moon 202771 6813747 16996 2.50 345329 706699 7.6 16.7 17.4% 0.0% 0.0% 0.0% 55.58sec 5440797 400.89sec
Buuey Buuey half_moon 202768 3143189 7840 1.19 336248 685946 7.9 7.9 17.4% 0.0% 0.0% 0.0% 53.04sec 3143189 400.89sec
Buuey Buuey lunar_strike 194153 23793325 59351 41.60 61637 125659 57.6 278.0 37.4% 0.0% 0.0% 0.0% 6.58sec 23793325 400.89sec
Buuey Buuey moonfire 8921 1119384 2792 2.82 50334 102571 18.8 18.8 17.5% 0.0% 0.0% 0.0% 21.99sec 8279948 400.89sec
Buuey Buuey moonfire ticks -8921 7160564 17901 37.11 24497 49983 18.8 247.4 17.4% 0.0% 0.0% 0.0% 21.99sec 8279948 400.89sec
Buuey Buuey moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Buuey Buuey new_moon 202767 1643254 4099 1.24 168124 342974 7.3 8.3 17.3% 0.0% 0.0% 0.0% 55.04sec 1643254 400.89sec
Buuey Buuey potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Buuey Buuey solar_wrath 190984 8919370 22249 10.37 108982 222367 70.0 69.3 17.4% 0.0% 0.0% 0.0% 5.67sec 8919370 400.89sec
Buuey Buuey starfall ticks -191034 20057542 50144 0.00 25062 51125 15.3 0.0 17.5% 0.0% 0.0% 0.0% 21.78sec 20057542 400.89sec
Buuey Buuey echoing_stars ticks -226104 3579432 8949 0.00 4770 9730 0.0 0.0 17.4% 0.0% 0.0% 0.0% 0.00sec 3579432 400.89sec
Buuey Buuey starsurge 78674 5281208 13174 2.15 268663 547736 14.4 14.4 35.4% 0.0% 0.0% 0.0% 27.97sec 5281208 400.89sec
Buuey Buuey goldrinns_fang 203001 883136 2203 0.71 158414 323195 4.7 4.7 17.4% 0.0% 0.0% 0.0% 67.44sec 883136 400.89sec
Buuey Buuey stellar_flare 202347 1262115 3148 2.09 76567 156260 14.0 14.0 17.4% 0.0% 0.0% 0.0% 29.54sec 7419612 400.89sec
Buuey Buuey stellar_flare ticks -202347 6157497 15394 30.21 25868 52786 14.0 201.4 17.5% 0.0% 0.0% 0.0% 29.54sec 7419612 400.89sec
Buuey Buuey sunfire 93402 3888803 9700 9.90 49789 101476 15.3 66.2 17.4% 0.0% 0.0% 0.0% 23.48sec 18551512 400.89sec
Buuey Buuey sunfire ticks -93402 14662709 36657 77.39 24060 49074 15.3 515.9 17.4% 0.0% 0.0% 0.0% 23.48sec 18551512 400.89sec
Buuey Buuey tormenting_cyclone 221857 4751023 11851 49.75 12095 24670 14.0 332.4 17.5% 0.0% 0.0% 0.0% 27.57sec 4751023 400.89sec
Oinkie Oinkie ashamanes_rip ticks -210705 4158435 10396 10.16 46109 94007 7.7 67.7 32.0% 0.0% 0.0% 0.0% 48.15sec 4158435 400.89sec
Oinkie Oinkie augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Oinkie Oinkie cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Oinkie Oinkie cat_melee 0 10147553 25312 64.70 17622 35952 432.3 432.3 31.9% 0.0% 0.0% 0.0% 0.93sec 14362280 400.89sec
Oinkie Oinkie dash 1850 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 188.73sec 0 400.89sec
Oinkie Oinkie ferocious_bite 22568 2942949 7341 2.21 142024 320901 14.8 14.8 31.9% 0.0% 0.0% 0.0% 28.20sec 4161255 400.89sec
Oinkie Oinkie flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Oinkie Oinkie food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Oinkie Oinkie incarnation 102543 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 400.89sec
Oinkie Oinkie lunar_inspiration 155625 760163 1896 2.62 32648 66629 17.5 17.5 31.9% 0.0% 0.0% 0.0% 23.65sec 5442445 400.89sec
Oinkie Oinkie lunar_inspiration ticks -155625 4682282 11706 22.13 23809 48574 17.5 147.5 32.0% 0.0% 0.0% 0.0% 23.65sec 5442445 400.89sec
Oinkie Oinkie potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Oinkie Oinkie potion_of_the_old_war 188028 4410682 11002 3.64 136135 277545 24.3 24.3 32.0% 0.0% 0.0% 0.0% 13.89sec 6484120 400.89sec
Oinkie Oinkie rake 1822 1704759 4252 2.86 66976 137142 19.1 19.1 31.9% 0.0% 0.0% 0.0% 22.42sec 9990314 400.89sec
Oinkie Oinkie rake ticks -1822 8285555 20714 16.67 55940 114222 19.1 111.2 31.9% 0.0% 0.0% 0.0% 22.42sec 9990314 400.89sec
Oinkie Oinkie rip ticks -1079 18589374 46473 46.78 44731 91259 23.3 311.8 32.0% 0.0% 0.0% 0.0% 14.28sec 18589374 400.89sec
Oinkie Oinkie shred 5221 9412429 23479 7.69 75265 217164 51.4 51.4 76.0% 0.0% 0.0% 0.0% 7.85sec 13285283 400.89sec
Oinkie Oinkie skull_bash 106839 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 30.24sec 0 400.89sec
Oinkie Oinkie swipe_cat 106785 28922841 72146 64.34 50508 103034 71.6 429.9 31.9% 0.0% 0.0% 0.0% 4.07sec 42084472 400.89sec
Oinkie Oinkie thrash_cat 106830 3677657 9174 22.04 18748 38250 24.5 147.2 31.9% 0.0% 0.0% 0.0% 12.08sec 13189349 400.89sec
Oinkie Oinkie thrash_cat ticks -106830 9511692 23779 85.03 12591 25684 24.5 566.9 32.0% 0.0% 0.0% 0.0% 12.08sec 13189349 400.89sec
Oinkie Oinkie tigers_fury 5217 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 30.53sec 0 400.89sec
Oinkie Oinkie wild_charge 102401 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 24.34sec 0 400.89sec
Rothlandra Rothlandra aimed_shot 19434 38562731 96192 16.05 230112 541629 107.3 107.2 41.6% 0.0% 0.0% 0.0% 3.71sec 56690867 400.89sec
Rothlandra Rothlandra legacy_of_the_windrunners 19434 6681570 16667 14.36 44606 105077 0.0 95.9 41.4% 0.0% 0.0% 0.0% 0.00sec 9822540 400.89sec
Rothlandra Rothlandra arcane_torrent 80483 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.02sec 0 400.89sec
Rothlandra Rothlandra augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Rothlandra Rothlandra auto_shot 0 5529831 13794 22.76 26010 55808 152.1 152.1 34.8% 0.0% 0.0% 0.0% 2.64sec 8129376 400.89sec
Rothlandra Rothlandra barrage ticks -120360 32269064 80673 44.25 22726 48291 19.3 295.0 32.9% 0.0% 0.0% 0.0% 21.27sec 47438581 400.89sec
Rothlandra Rothlandra deadly_grace 188091 3389569 8455 4.60 79173 184330 30.9 30.7 29.6% 0.0% 0.0% 0.0% 3.61sec 3389569 400.89sec
Rothlandra Rothlandra flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Rothlandra Rothlandra marked_shot 185901 46449744 115866 16.39 304753 644275 34.7 109.5 35.1% 0.0% 0.0% 0.0% 11.59sec 68285523 400.89sec
Rothlandra Rothlandra pepper_breath ticks -225622 1572378 3931 14.07 16975 0 18.9 93.8 0.0% 0.0% 0.0% 0.0% 21.10sec 1572378 400.89sec
Rothlandra Rothlandra potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Rothlandra Rothlandra sidewinders 214579 20065528 50052 21.69 102802 215232 42.6 144.9 31.7% 0.0% 0.0% 0.0% 9.46sec 20065528 400.89sec
Rothlandra Rothlandra trueshot 193526 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 181.25sec 0 400.89sec
Rothlandra Rothlandra windburst 204147 8071449 20134 2.47 356762 742530 15.5 16.5 34.5% 0.0% 0.0% 0.0% 25.00sec 11865795 400.89sec
Sarkul Sarkul aimed_shot 19434 45773323 114179 17.66 268286 623578 118.1 118.0 33.7% 0.0% 0.0% 0.0% 3.39sec 67291120 400.89sec
Sarkul Sarkul legacy_of_the_windrunners 19434 8010028 19981 15.89 52062 121284 0.0 106.2 33.8% 0.0% 0.0% 0.0% 0.00sec 11775500 400.89sec
Sarkul Sarkul augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Sarkul Sarkul auto_shot 0 5482312 13675 24.38 25468 55133 162.9 162.9 27.6% 0.0% 0.0% 0.0% 2.47sec 8059519 400.89sec
Sarkul Sarkul volley 194386 29356026 73227 82.88 41882 87605 163.9 553.8 24.3% 0.0% 0.0% 0.0% 2.47sec 43156138 400.89sec
Sarkul Sarkul blood_fury 20572 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.49sec 0 400.89sec
Sarkul Sarkul deadly_grace 188091 3782614 9435 4.76 80707 204804 31.8 31.8 30.8% 0.0% 0.0% 0.0% 10.56sec 3782614 400.89sec
Sarkul Sarkul flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Sarkul Sarkul mark_of_the_hidden_satyr 191259 1540583 3843 3.44 50459 109442 23.0 23.0 28.1% 0.0% 0.0% 0.0% 17.35sec 1540583 400.89sec
Sarkul Sarkul marked_shot 185901 45174587 112685 15.07 323356 681836 36.7 100.7 35.0% 0.0% 0.0% 0.0% 10.98sec 66410921 400.89sec
Sarkul Sarkul call_of_the_hunter 191070 4004031 9988 7.37 62996 133978 14.8 49.2 25.8% 0.0% 0.0% 0.0% 51.37sec 5886305 400.89sec
Sarkul Sarkul pepper_breath ticks -225622 1535591 3839 13.69 16975 0 18.3 91.2 0.0% 0.0% 0.0% 0.0% 21.72sec 1535591 400.89sec
Sarkul Sarkul potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Sarkul Sarkul rancid_maw 215405 4679995 11674 2.73 193161 419710 18.4 18.3 27.8% 0.0% 0.0% 0.0% 21.53sec 4679995 400.89sec
Sarkul Sarkul sidewinders 214579 18613485 46430 21.01 104545 218760 41.9 140.4 24.5% 0.0% 0.0% 0.0% 9.64sec 18613485 400.89sec
Sarkul Sarkul tormenting_cyclone 221857 4854102 12108 48.42 11830 24751 13.7 323.5 24.6% 0.0% 0.0% 0.0% 28.47sec 4854102 400.89sec
Sarkul Sarkul trueshot 193526 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 203.74sec 0 400.89sec
Sarkul Sarkul windburst 204147 8408587 20975 2.51 386417 807316 15.8 16.8 27.3% 0.0% 0.0% 0.0% 24.63sec 12361419 400.89sec
Mellarene Mellarene arcane_torrent 28730 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 118.44sec 0 400.89sec
Mellarene Mellarene augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Mellarene Mellarene combustion 190319 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 83.99sec 0 400.89sec
Mellarene Mellarene conflagration_dot ticks -226757 306600 767 26.98 1705 0 99.6 179.9 0.0% 0.0% 0.0% 0.0% 3.87sec 306600 400.89sec
Mellarene Mellarene conflagration_explosion 205023 8276825 20646 47.15 13852 33644 69.1 315.1 62.7% 0.0% 0.0% 0.0% 5.64sec 8276825 400.89sec
Mellarene Mellarene counterspell 2139 0 0 0.00 0 0 9.8 0.0 0.0% 0.0% 0.0% 0.0% 42.16sec 0 400.89sec
Mellarene Mellarene deadly_grace 188091 4186567 10443 3.22 80281 229927 21.6 21.5 76.5% 0.0% 0.0% 0.0% 5.28sec 4186567 400.89sec
Mellarene Mellarene fire_blast 108853 6025810 15031 6.88 0 130989 46.0 46.0 100.0% 0.0% 0.0% 0.0% 8.77sec 6025810 400.89sec
Mellarene Mellarene fireball 133 11402719 28443 14.91 63133 140078 99.8 99.6 66.7% 0.0% 0.0% 0.0% 3.87sec 11402719 400.89sec
Mellarene Mellarene flame_on 205029 0 0 0.00 0 0 5.7 0.0 0.0% 0.0% 0.0% 0.0% 80.74sec 0 400.89sec
Mellarene Mellarene flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Mellarene Mellarene food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Mellarene Mellarene ignite ticks -12846 22457655 56144 103.81 32450 0 311.1 692.0 0.0% 0.0% 0.0% 0.0% 1.33sec 22457655 400.89sec
Mellarene Mellarene living_bomb ticks -44457 4698136 11745 46.47 8353 19696 95.9 309.8 60.1% 0.0% 0.0% 0.0% 8.68sec 4698136 400.89sec
Mellarene Mellarene living_bomb_explosion 44461 25208132 62880 77.04 26771 63690 95.9 514.8 60.1% 0.0% 0.0% 0.0% 8.65sec 25208132 400.89sec
Mellarene Mellarene mark_of_the_hidden_satyr 191259 3525753 8795 3.28 84340 206944 21.9 21.9 62.5% 0.0% 0.0% 0.0% 18.18sec 3525753 400.89sec
Mellarene Mellarene phoenix_reborn 215773 1374455 3428 6.27 17118 42007 41.9 41.9 63.0% 0.0% 0.0% 0.0% 9.32sec 1374455 400.89sec
Mellarene Mellarene phoenixs_flames 194466 5994708 14953 2.92 0 307112 19.6 19.5 100.0% 0.0% 0.0% 0.0% 21.05sec 5994708 400.89sec
Mellarene Mellarene phoenixs_flames_splash 224637 4845301 12086 7.58 0 95612 19.5 50.7 100.0% 0.0% 0.0% 0.0% 21.09sec 4845301 400.89sec
Mellarene Mellarene potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Mellarene Mellarene pyroblast 11366 30783446 76787 14.26 142072 385374 94.5 95.3 74.4% 0.0% 0.0% 0.0% 4.25sec 30783446 400.89sec
Mellarene Mellarene rune_of_power 116011 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 52.00sec 0 400.89sec
Mellarene Mellarene scorch 2948 5733 14 0.02 0 48870 0.1 0.1 100.0% 0.0% 0.0% 0.0% 55.93sec 5733 400.89sec
Mellarene Mellarene tormenting_cyclone 221857 6914473 17248 47.16 11996 28041 13.1 315.1 62.0% 0.0% 0.0% 0.0% 29.47sec 6914473 400.89sec
Mellarene Mellarene volatile_ichor 222187 11893248 29667 8.77 111922 260070 17.5 58.6 61.4% 0.0% 0.0% 0.0% 22.48sec 11893248 400.89sec
Zipi Zipi augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Zipi Zipi blade_of_justice 184575 13926582 34739 7.59 185169 570816 50.7 50.7 23.1% 0.0% 0.0% 0.0% 7.92sec 20473395 400.89sec
Zipi Zipi blessing_of_might_proc 205729 12782915 31886 40.48 47262 0 363.0 270.5 0.0% 0.0% 0.0% 0.0% 2.01sec 12782915 400.89sec
Zipi Zipi crusade 231895 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 125.30sec 0 400.89sec
Zipi Zipi divine_storm 53385 40016893 99820 36.36 132782 270930 40.5 242.9 23.1% 0.0% 0.0% 0.0% 7.28sec 40016893 400.89sec
Zipi Zipi execution_sentence ticks -213757 9674317 24186 2.48 470908 960733 16.9 16.6 23.2% 0.0% 0.0% 0.0% 24.68sec 9674317 400.89sec
Zipi Zipi flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Zipi Zipi food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Zipi Zipi greater_blessing_of_might 203528 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Zipi Zipi judgment 20271 9726419 24262 6.63 177080 361063 44.3 44.3 23.2% 0.0% 0.0% 0.0% 9.06sec 9726419 400.89sec
Zipi Zipi judgment_aoe 228288 4852337 12104 3.44 170050 346841 44.3 23.0 23.1% 0.0% 0.0% 0.0% 9.06sec 4852337 400.89sec
Zipi Zipi melee 0 4826993 12041 17.46 33361 68023 116.7 116.7 23.1% 0.0% 0.0% 0.0% 3.43sec 7096137 400.89sec
Zipi Zipi potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Zipi Zipi potion_of_the_old_war 188028 6099921 15216 4.47 165001 336502 29.8 29.8 23.0% 0.0% 0.0% 0.0% 5.28sec 8967462 400.89sec
Zipi Zipi rebuke 96231 0 0 0.00 0 0 13.8 0.0 0.0% 0.0% 0.0% 0.0% 29.59sec 0 400.89sec
Zipi Zipi rend_flesh ticks -221770 1150233 2876 12.66 10990 22413 22.0 84.4 23.1% 0.0% 0.0% 0.0% 18.02sec 1150233 400.89sec
Zipi Zipi shield_of_vengeance 184662 0 0 0.57 0 0 3.8 3.8 23.2% 0.0% 0.0% 0.0% 120.00sec 2651117 400.89sec
Zipi Zipi shield_of_vengeance_proc 184689 3964249 9889 0.55 875842 1788020 3.8 3.7 22.8% 0.0% 0.0% 0.0% 119.63sec 3964249 400.89sec
Zipi Zipi templars_verdict 85256 12235249 30520 5.23 281922 575154 35.0 35.0 23.2% 0.0% 0.0% 0.0% 11.56sec 12235249 400.89sec
Zipi Zipi wake_of_ashes 205273 13419546 33474 7.77 208598 425573 13.3 51.9 23.1% 0.0% 0.0% 0.0% 31.40sec 19543738 400.89sec
Zipi Zipi wake_of_ashes ticks -205273 6124192 15310 23.11 32052 65382 13.3 154.1 23.1% 0.0% 0.0% 0.0% 31.40sec 19543738 400.89sec
Zipi Zipi zeal 217020 29932905 74666 43.30 72509 147920 117.5 289.3 41.0% 0.0% 0.0% 0.0% 3.40sec 44004206 400.89sec
Faelik Faelik augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Faelik Faelik deadly_grace 188091 3741598 9333 4.54 96616 193581 30.4 30.3 27.6% 0.0% 0.0% 0.0% 13.59sec 3741598 400.89sec
Faelik Faelik flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Faelik Faelik food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Faelik Faelik mark_of_the_hidden_satyr 191259 4221896 10531 4.77 103587 207291 31.9 31.9 27.8% 0.0% 0.0% 0.0% 12.46sec 4221896 400.89sec
Faelik Faelik mind_blast 8092 13002216 32433 8.78 173440 347310 57.6 58.6 27.8% 0.0% 0.0% 0.0% 6.87sec 13002216 400.89sec
Faelik Faelik mind_flay ticks -15407 6974998 17437 23.65 34580 69294 56.3 157.7 27.8% 0.0% 0.0% 0.0% 7.17sec 6974998 400.89sec
Faelik Faelik mind_sear ticks -48045 17280858 43202 12.58 28395 56816 35.3 83.9 27.8% 0.0% 0.0% 0.0% 8.04sec 17280858 400.89sec
Faelik Faelik potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Faelik Faelik power_infusion 10060 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 122.17sec 0 400.89sec
Faelik Faelik shadow_word_death 32379 1949417 4863 1.19 192968 386038 7.9 7.9 27.4% 0.0% 0.0% 0.0% 9.99sec 1949417 400.89sec
Faelik Faelik shadow_word_pain 589 2581626 6440 7.43 40681 81665 49.6 49.6 27.6% 0.0% 0.0% 0.0% 7.86sec 25011972 400.89sec
Faelik Faelik shadow_word_pain ticks -589 22430346 56076 52.60 50008 100194 49.6 350.7 27.8% 0.0% 0.0% 0.0% 7.86sec 25011972 400.89sec
Faelik Faelik sphere_of_insanity 194182 5337110 13313 57.61 13865 0 290.3 384.9 0.0% 0.0% 0.0% 0.0% 1.33sec 0 400.89sec
Faelik Faelik shadowfiend 34433 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 197.77sec 0 400.89sec
Faelik Faelik shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Faelik Faelik shadowy_apparitions 78203 6569092 16386 26.16 29185 58418 176.2 174.8 28.7% 0.0% 0.0% 0.0% 2.25sec 6569092 400.89sec
Faelik Faelik touch_of_the_grave 127802 1334716 3329 3.79 52743 0 25.3 25.3 0.0% 0.0% 0.0% 0.0% 16.09sec 1334716 400.89sec
Faelik Faelik vampiric_touch ticks -34914 51638482 129096 70.80 85564 171337 39.1 472.0 27.8% 0.0% 0.0% 0.0% 7.81sec 51638482 400.89sec
Faelik Faelik void_bolt 205448 22742132 56729 14.19 187584 375138 95.1 94.8 27.9% 0.0% 0.0% 0.0% 4.03sec 22742132 400.89sec
Faelik Faelik void_eruption 228360 3961008 9880 7.53 61598 123150 10.7 50.3 27.8% 0.0% 0.0% 0.0% 38.03sec 3961008 400.89sec
Faelik Faelik void_torrent ticks -205065 5638294 14096 5.46 121160 242109 6.8 36.4 27.8% 0.0% 0.0% 0.0% 61.85sec 5638294 400.89sec
Faelik Faelik_shadowfiend melee 0 3003412 108381 72.09 70601 141232 33.3 33.3 27.8% 0.0% 0.0% 0.0% 8.58sec 3003412 27.71sec
Faelik Faelik_shadowfiend shadowcrawl 63619 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 74.56sec 0 27.71sec
Raji Raji augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Raji Raji berserking 26297 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 185.95sec 0 400.89sec
Raji Raji deadly_grace 188091 3734959 9317 4.29 98068 196245 28.7 28.7 32.8% 0.0% 0.0% 0.0% 14.43sec 3734959 400.89sec
Raji Raji flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Raji Raji food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Raji Raji mind_blast 8092 9094560 22686 7.40 138570 277151 48.4 49.4 32.8% 0.0% 0.0% 0.0% 8.20sec 9094560 400.89sec
Raji Raji mind_flay ticks -15407 5414104 13535 18.97 32253 64496 47.8 126.5 32.7% 0.0% 0.0% 0.0% 8.44sec 5414104 400.89sec
Raji Raji mind_sear ticks -48045 15427863 38570 10.64 28747 57509 28.0 70.9 32.7% 0.0% 0.0% 0.0% 10.22sec 15427863 400.89sec
Raji Raji mindbender 200174 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 60.46sec 0 400.89sec
Raji Raji potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Raji Raji shadow_word_death 32379 3416501 8522 2.12 181474 363030 14.2 14.2 32.7% 0.0% 0.0% 0.0% 10.17sec 3416501 400.89sec
Raji Raji shadow_word_pain 589 1867521 4658 6.21 33914 67841 41.5 41.5 32.7% 0.0% 0.0% 0.0% 9.39sec 17508374 400.89sec
Raji Raji shadow_word_pain ticks -589 15640853 39102 44.51 39724 79438 41.5 296.7 32.7% 0.0% 0.0% 0.0% 9.39sec 17508374 400.89sec
Raji Raji shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Raji Raji shadowy_apparitions 78203 5884551 14679 24.83 26725 53460 167.4 165.9 32.7% 0.0% 0.0% 0.0% 2.36sec 5884551 400.89sec
Raji Raji vampiric_touch ticks -34914 31834962 79587 53.74 66954 133953 33.7 358.2 32.7% 0.0% 0.0% 0.0% 9.07sec 31834962 400.89sec
Raji Raji void_bolt 205448 19891589 49618 12.14 184736 369534 81.4 81.1 32.7% 0.0% 0.0% 0.0% 4.79sec 19891589 400.89sec
Raji Raji void_eruption 228360 3990808 9955 7.53 59809 119668 11.5 50.3 32.6% 0.0% 0.0% 0.0% 35.45sec 3990808 400.89sec
Raji Raji void_torrent ticks -205065 6122205 15306 6.37 108573 216904 6.9 42.5 32.8% 0.0% 0.0% 0.0% 61.24sec 6122205 400.89sec
Raji Raji volatile_ichor 222187 12587371 31398 11.15 127311 254705 22.0 74.5 32.6% 0.0% 0.0% 0.0% 17.94sec 12587371 400.89sec
Raji Raji_mindbender melee 0 6480027 61640 51.99 53608 107213 91.1 91.1 32.7% 0.0% 0.0% 0.0% 4.27sec 6480027 105.13sec
Raji Raji_mindbender shadowcrawl 63619 0 0 0.00 0 0 21.1 0.0 0.0% 0.0% 0.0% 0.0% 18.93sec 0 105.13sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 1941810 4855 6.93 31708 63416 9.2 46.2 32.6% 0.0% 0.0% 0.0% 40.53sec 1941810 63.84sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 415428 1039 1.48 31708 63416 2.0 9.9 32.7% 0.0% 0.0% 0.0% 63.80sec 415428 13.48sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 319820 800 1.14 31708 63416 1.4 7.6 32.5% 0.0% 0.0% 0.0% 24.93sec 319820 9.80sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 332935 832 1.16 31708 63416 1.1 7.7 36.1% 0.0% 0.0% 0.0% 5.25sec 332935 9.23sec
Vait Vait adrenaline_rush 13750 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 71.13sec 0 400.89sec
Vait Vait ambush 8676 1049785 2619 1.05 111659 224020 7.0 7.0 33.9% 0.0% 0.0% 0.0% 64.41sec 1543283 400.89sec
Vait Vait augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Vait Vait auto_attack_mh 0 8107595 20224 38.32 27024 54053 256.0 256.0 36.2% 19.0% 0.0% 0.0% 1.57sec 11918933 400.89sec
Vait Vait auto_attack_oh 1 3762135 9384 35.54 13516 27031 237.5 237.5 36.2% 19.0% 0.0% 0.0% 1.69sec 5530695 400.89sec
Vait Vait blade_flurry 13877 0 0 0.00 0 0 10.0 0.0 0.0% 0.0% 0.0% 0.0% 29.99sec 0 400.89sec
Vait Vait blade_flurry_attack 22482 31965846 79737 311.48 15360 0 416.2 2081.2 0.0% 0.0% 0.0% 0.0% 0.98sec 46992822 400.89sec
Vait Vait curse_of_the_dreadblades 202665 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.85sec 0 400.89sec
Vait Vait flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Vait Vait food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Vait Vait ghostly_strike 196937 1612667 4023 4.04 43847 87784 27.0 27.0 36.2% 0.0% 0.0% 0.0% 15.05sec 2370773 400.89sec
Vait Vait gouge 1776 0 0 0.00 0 0 20.0 0.0 0.0% 0.0% 0.0% 0.0% 18.14sec 0 400.89sec
Vait Vait greed 202822 13168868 32849 17.38 83171 166357 34.7 116.1 36.3% 0.0% 0.0% 0.0% 11.29sec 19359483 400.89sec
Vait Vait greed_oh 202823 6584958 16426 17.38 41582 83190 34.7 116.1 36.3% 0.0% 0.0% 0.0% 11.29sec 9680512 400.89sec
Vait Vait main_gauche 86392 9578473 23893 35.99 29248 58499 240.5 240.5 36.2% 0.0% 0.0% 0.0% 1.69sec 14081262 400.89sec
Vait Vait marked_for_death 137619 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.01sec 0 400.89sec
Vait Vait pistol_shot 185763 3034734 7570 6.56 44892 89778 43.8 43.8 54.2% 0.0% 0.0% 0.0% 8.61sec 4461347 400.89sec
Vait Vait potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Vait Vait potion_of_the_old_war 188028 4731906 11803 3.94 131868 264271 26.3 26.3 36.1% 0.0% 0.0% 0.0% 5.44sec 6956349 400.89sec
Vait Vait roll_the_bones 193316 0 0 0.00 0 0 16.3 0.0 0.0% 0.0% 0.0% 0.0% 24.34sec 0 400.89sec
Vait Vait run_through 2098 45565842 113661 14.86 336437 672152 99.3 99.3 36.5% 0.0% 0.0% 0.0% 4.00sec 66986104 400.89sec
Vait Vait saber_slash 193315 23631762 58948 32.43 80092 160199 216.7 216.7 36.2% 0.0% 0.0% 0.0% 1.85sec 34740929 400.89sec
Vait Vait sprint 2983 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 49.15sec 0 400.89sec
Vait Vait touch_of_the_grave 127802 1056255 2635 3.61 43756 0 24.1 24.1 0.0% 0.0% 0.0% 0.0% 16.89sec 1056255 400.89sec
Vait Vait vanish 1856 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 64.19sec 0 400.89sec
Bowflexn Bowflexn augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Bowflexn Bowflexn boulderfist 201897 14265816 35585 11.60 138181 281982 77.5 77.5 31.9% 0.0% 0.0% 0.0% 5.18sec 14265816 400.89sec
Bowflexn Bowflexn crash_lightning 187874 15340401 38266 39.09 44084 89926 64.9 261.2 32.0% 0.0% 0.0% 0.0% 6.11sec 15340401 400.89sec
Bowflexn Bowflexn crashing_storm 210801 15366090 38330 251.43 6861 13998 402.8 1680.0 32.0% 0.0% 0.0% 0.0% 0.98sec 15366090 400.89sec
Bowflexn Bowflexn doom_winds 204945 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 62.30sec 0 400.89sec
Bowflexn Bowflexn feral_spirit 51533 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.36sec 0 400.89sec
Bowflexn Bowflexn flametongue 193796 2685147 6698 4.54 66414 135510 30.3 30.3 32.0% 0.0% 0.0% 0.0% 13.30sec 2685147 400.89sec
Bowflexn Bowflexn flametongue_attack 10444 8954146 22336 164.06 6128 12502 1096.2 1096.2 32.0% 0.0% 0.0% 0.0% 1.16sec 8954146 400.89sec
Bowflexn Bowflexn flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Bowflexn Bowflexn food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Bowflexn Bowflexn frostbrand 196834 1675273 4179 3.67 51185 104414 24.5 24.5 32.1% 0.0% 0.0% 0.0% 16.55sec 1675273 400.89sec
Bowflexn Bowflexn hailstorm 210854 22108702 55149 160.72 15447 31513 1073.8 1073.8 32.0% 0.0% 0.0% 0.0% 1.18sec 22108702 400.89sec
Bowflexn Bowflexn lava_lash 60103 2483143 6194 2.51 111357 227032 16.8 16.8 31.7% 0.0% 0.0% 0.0% 22.74sec 2483143 400.89sec
Bowflexn Bowflexn lava_lash_cl 195592 1935818 4829 4.93 44068 89891 8.0 32.9 32.1% 0.0% 0.0% 0.0% 29.84sec 1935818 400.89sec
Bowflexn Bowflexn main_hand 0 3894440 9714 24.86 20530 41896 166.1 166.1 31.9% 19.0% 0.0% 0.0% 2.43sec 5725195 400.89sec
Bowflexn Bowflexn mark_of_the_hidden_satyr 191259 4613584 11508 3.67 141344 288471 24.5 24.5 31.8% 0.0% 0.0% 0.0% 16.32sec 4613584 400.89sec
Bowflexn Bowflexn offhand 1 1943968 4849 24.77 10269 20954 165.5 165.5 32.1% 19.0% 0.0% 0.0% 2.43sec 2857818 400.89sec
Bowflexn Bowflexn potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Bowflexn Bowflexn potion_of_the_old_war 188028 3546957 8848 3.21 124289 253729 21.5 21.5 31.7% 0.0% 0.0% 0.0% 7.34sec 5214363 400.89sec
Bowflexn Bowflexn stormlash 213307 6240785 15567 78.88 11842 0 527.0 527.0 0.0% 0.0% 0.0% 0.0% 1.81sec 6240785 400.89sec
Bowflexn Bowflexn stormstrike 17364 0 0 0.00 0 0 112.6 0.0 0.0% 0.0% 0.0% 0.0% 3.52sec 0 400.89sec
Bowflexn Bowflexn stormstrike_cl 195592 21467914 53550 54.60 44159 90085 81.6 364.8 32.0% 0.0% 0.0% 0.0% 3.59sec 21467914 400.89sec
Bowflexn Bowflexn stormstrike_mh 32175 26824427 66912 21.07 143117 291408 140.8 140.8 32.0% 0.0% 0.0% 0.0% 3.52sec 39434448 400.89sec
Bowflexn Bowflexn stormstrike_offhand 32176 13419077 33473 21.07 71510 145915 140.8 140.8 32.0% 0.0% 0.0% 0.0% 3.52sec 19727314 400.89sec
Bowflexn Bowflexn unleash_lava 199053 3605225 8993 10.31 39256 80096 69.2 68.9 32.1% 0.0% 0.0% 0.0% 8.64sec 3605225 400.89sec
Bowflexn Bowflexn unleash_lightning 199054 3612482 9011 10.34 39257 80080 69.4 69.1 32.0% 0.0% 0.0% 0.0% 8.59sec 3612482 400.89sec
Bowflexn Bowflexn wind_shear 57994 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 28.33sec 0 400.89sec
Bowflexn Bowflexn windfury_attack 25504 8926460 22267 40.95 24458 50000 273.6 273.6 32.0% 0.0% 0.0% 0.0% 3.58sec 13122741 400.89sec
Bowflexn Bowflexn windfury_attack_oh 33750 1077841 2689 4.35 27838 56789 29.1 29.1 32.0% 0.0% 0.0% 0.0% 26.84sec 1584529 400.89sec
Bowflexn Bowflexn_frost_wolf frozen_bite 224126 1761617 73606 23.83 140116 280251 9.5 9.5 32.2% 0.0% 0.0% 0.0% 35.89sec 1761617 23.93sec
Bowflexn Bowflexn_frost_wolf melee 0 1058731 44237 114.81 17504 35017 45.8 45.8 32.1% 0.0% 0.0% 0.0% 6.75sec 1556436 23.93sec
Bowflexn Bowflexn_frost_wolf snowstorm 198483 1988222 83074 101.09 37341 74713 15.7 40.3 32.0% 0.0% 0.0% 0.0% 19.38sec 1988222 23.93sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws 224125 1162076 48389 23.59 93413 186870 9.4 9.4 31.7% 0.0% 0.0% 0.0% 35.71sec 2565613 24.02sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws ticks -224125 1403537 3509 5.63 37376 0 9.4 37.6 0.0% 0.0% 0.0% 0.0% 35.71sec 2565613 24.02sec
Bowflexn Bowflexn_fiery_wolf fire_nova 198480 1964809 81816 99.49 37364 74695 15.5 39.8 32.1% 0.0% 0.0% 0.0% 19.27sec 1964809 24.02sec
Bowflexn Bowflexn_fiery_wolf melee 0 1053368 43863 113.89 17504 35018 45.6 45.6 32.0% 0.0% 0.0% 0.0% 6.70sec 1548551 24.02sec
Bowflexn Bowflexn_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 36.33sec 0 23.63sec
Bowflexn Bowflexn_lightning_wolf melee 0 1527462 64643 119.95 24481 48979 47.2 47.2 32.1% 0.0% 0.0% 0.0% 6.35sec 2245514 23.63sec
Bowflexn Bowflexn_lightning_wolf thunder_bite 198485 2160903 91451 90.39 45956 91867 15.8 35.6 32.1% 0.0% 0.0% 0.0% 19.54sec 2160903 23.63sec
Alacastria Alacastria arcane_torrent 69179 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 90.29sec 0 400.89sec
Alacastria Alacastria augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Alacastria Alacastria auto_attack_mh 0 5162559 12878 24.63 25488 54456 164.6 164.6 20.3% 0.0% 0.0% 7.5% 2.45sec 7763541 400.89sec
Alacastria Alacastria battle_cry 1719 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 60.72sec 0 400.89sec
Alacastria Alacastria deep_wounds ticks -115767 20688639 51722 55.54 43491 93037 317.5 370.2 25.0% 0.0% 0.0% 0.0% 2.19sec 20688639 400.89sec
Alacastria Alacastria demoralizing_shout 1160 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 121.38sec 0 400.89sec
Alacastria Alacastria devastate 20243 13144056 32787 21.01 77476 164545 140.4 140.4 18.5% 0.0% 0.0% 7.6% 2.86sec 19772092 400.89sec
Alacastria Alacastria flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Alacastria Alacastria food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Alacastria Alacastria gaseous_bubble 214972 11065522 27602 4.78 200341 411783 7.0 31.9 69.2% 0.0% 0.0% 0.0% 60.03sec 11065522 400.89sec
Alacastria Alacastria ignore_pain 190456 20273851 50572 35.55 85342 0 26.7 237.6 0.0% 0.0% 0.0% 0.0% 15.49sec 0 400.89sec
Alacastria Alacastria intercept 198304 0 0 0.00 0 0 20.1 0.0 0.0% 0.0% 0.0% 0.0% 20.42sec 0 400.89sec
Alacastria Alacastria neltharions_fury ticks -203524 14845027 37113 4.50 38999 82465 5.0 30.0 100.0% 0.0% 0.0% 0.0% 60.64sec 14845027 400.89sec
Alacastria Alacastria potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.89sec
Alacastria Alacastria revenge 6572 21394154 53366 26.51 95786 202805 42.5 177.1 23.4% 0.0% 0.0% 5.2% 9.24sec 31618681 400.89sec
Alacastria Alacastria shield_block 2565 0 0 0.00 0 0 28.8 0.0 0.0% 0.0% 0.0% 0.0% 14.27sec 0 400.89sec
Alacastria Alacastria shield_block_heavy_repercussions 2565 0 0 0.00 0 0 49.1 0.0 0.0% 0.0% 0.0% 0.0% 8.31sec 0 400.89sec
Alacastria Alacastria shield_slam 23922 13102763 32684 8.45 169686 362037 56.4 56.4 32.5% 0.0% 0.0% 7.5% 7.21sec 19704309 400.89sec
Alacastria Alacastria thunder_clap 6343 9776953 24388 24.38 46915 99489 27.2 162.9 24.9% 0.0% 0.0% 0.0% 10.86sec 14373046 400.89sec

Fluffy_Pillow : 74697 dps, 0 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
74697.3 74697.3 50.2 / 0.067% 10045.0 / 13.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 84.43% 5.5 100.0% 100%
Talents
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for Fluffy_Pillow Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_PillowTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow 74697
melee_main_hand_Alacastria 9185 12.3% 198.9 2.00sec 18499 9249 Direct 186.4 22785 0 19741 0.0% 13.4% 60.7%  

Stats details: melee_main_hand_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.94 186.43 0.00 0.00 2.0000 0.0000 3680159.32 42766505.37 91.39 9249.33 9249.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.29 25.90% 34006.17 0 176315 33996.00 14271 63451 1642070 12787226 87.16
hit (blocked) 54.03 28.98% 23158.76 1 123420 23222.29 10292 42940 1251309 14304754 91.23
hit (crit blocked) 59.20 31.75% 13291.25 2 70526 13323.16 5717 23019 786781 15674525 94.97
parry 24.91 13.36% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Alacastria

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_main_hand_Illistan 42033 56.3% 198.9 2.00sec 84758 42379 Direct 198.9 128518 0 84757 0.0% 34.0% 0.0%  

Stats details: melee_main_hand_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.94 198.94 0.00 0.00 2.0000 0.0000 16862015.15 34736573.92 51.46 42379.22 42379.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.20 65.95% 128518.01 45977 180046 128492.29 102392 135520 16862015 34736574 51.47
parry 47.86 24.06% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 19.88 9.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Illistan

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_nuke_Alacastria 761 1.0% 14.0 29.10sec 21877 10939 Direct 12.1 25296 0 25296 0.0% 0.0% 74.7%  

Stats details: melee_nuke_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.02 12.12 0.00 0.00 2.0000 0.0000 306692.18 3794264.94 91.92 10938.84 10938.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.07 25.33% 35026.05 1 208354 33493.31 0 208338 107584 961438 85.53
hit (blocked) 4.38 36.13% 28019.28 1 145857 27748.15 0 140364 122742 1371101 90.54
hit (crit blocked) 4.67 38.54% 16347.73 0 83348 16295.13 0 83057 76367 1461726 94.42
 
 

Action details: melee_nuke_Alacastria

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
melee_nuke_Illistan 5279 7.1% 14.0 29.10sec 150962 75314 Direct 14.0 150963 0 150963 0.0% 0.0% 0.0%  

Stats details: melee_nuke_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.02 14.02 0.00 0.00 2.0045 0.0000 2116323.58 4386813.96 51.76 75314.01 75314.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.02 100.00% 150962.61 54337 212780 150883.84 119323 171039 2116324 4386814 51.78
 
 

Action details: melee_nuke_Illistan

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
spell_dot_Alacastria 2719 3.6% 10.2 41.06sec 106965 106973 Periodic 92.2 11823 0 11823 0.0% 0.0% 0.0% 49.5%

Stats details: spell_dot_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.19 0.00 99.21 92.15 1.0000 2.0000 1089517.96 5545039.14 80.35 5222.70 106972.80
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.2 100.00% 11823.34 1 55419 11831.79 5469 18343 1089518 5545039 80.34
 
 

Action details: spell_dot_Alacastria

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_dot_Illistan 11764 15.7% 10.2 41.06sec 462897 460848 Periodic 99.2 47523 0 47523 0.0% 0.0% 0.0% 49.5%

Stats details: spell_dot_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.19 0.00 99.21 99.21 1.0045 2.0000 4714937.66 5969981.24 21.02 22596.49 460848.17
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.2 100.00% 47523.04 21799 51903 47527.06 46687 48604 4714938 5969981 21.02
 
 

Action details: spell_dot_Illistan

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:!ticking
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_nuke_Alacastria 645 0.9% 11.2 37.11sec 23176 11588 Direct 9.3 27690 0 27690 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.16 9.34 0.00 0.00 2.0000 0.0000 258546.52 1235950.95 79.08 11588.30 11588.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.34 100.00% 27689.76 4 134111 27796.27 10363 96156 258547 1235951 79.00
 
 

Action details: spell_nuke_Alacastria

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
spell_nuke_Illistan 2312 3.1% 11.2 37.11sec 83060 41438 Direct 11.2 83061 0 83061 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.16 11.16 0.00 0.00 2.0045 0.0000 926590.05 1476901.19 37.26 41437.77 41437.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.16 100.00% 83060.87 43162 125602 83035.68 74872 92800 926590 1476901 37.28
 
 

Action details: spell_nuke_Illistan

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
Simple Action Stats Execute Interval
Fluffy_Pillow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.63% 9.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.63%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.67% 9.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.69% 10.69% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.69%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.07% 11.07% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.00% 11.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.54% 10.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.70% 10.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.48% 11.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.85% 9.85% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.38% 5.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Anguish 7.4 64.3 54.4sec 4.9sec 6.27% 6.27% 0.0(0.0) 7.3

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.32%
  • anguish_2:0.31%
  • anguish_3:0.32%
  • anguish_4:0.33%
  • anguish_5:0.32%
  • anguish_6:0.31%
  • anguish_7:0.31%
  • anguish_8:0.31%
  • anguish_9:0.31%
  • anguish_10:3.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Anguish 11.7 100.0 33.1sec 3.2sec 10.22% 10.22% 0.0(0.0) 11.7

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.65%
  • anguish_2:0.53%
  • anguish_3:0.53%
  • anguish_4:0.53%
  • anguish_5:0.52%
  • anguish_6:0.56%
  • anguish_7:0.51%
  • anguish_8:0.54%
  • anguish_9:0.52%
  • anguish_10:5.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Demoralizing Shout (_debuff) 3.7 0.0 121.8sec 121.4sec 7.40% 7.11% 0.0(0.0) 3.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_demoralizing_shout_debuff
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.20

Stack Uptimes

  • demoralizing_shout_debuff_1:7.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing $s1% less damage.][Demoralized, dealing $s1% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by $s1% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by $s1% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Ghostly Strike 5.6 21.4 67.5sec 15.1sec 96.52% 96.88% 103.5(103.5) 4.6

Buff details

  • buff initial source:Vait
  • cooldown name:buff_ghostly_strike
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • ghostly_strike_1:96.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196937
  • name:Ghostly Strike
  • tooltip:Taking $s5% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take $s5% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards $s1 combo $lpoint:points;.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 36.9 0.0 10.9sec 10.9sec 38.95% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:38.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 34.9 0.3 11.5sec 11.4sec 26.99% 100.00% 0.3(0.3) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:26.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 32.9 55.6 12.2sec 4.5sec 82.59% 93.87% 55.6(55.6) 32.1

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:82.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Marked for Death 0.5 0.4 149.1sec 7.8sec 7.77% 7.77% 0.4(0.4) 0.5

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:7.77%

Trigger Attempt Success

  • trigger_pct:45.63%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Open Wounds 9.1 8.0 36.2sec 19.6sec 77.60% 78.66% 8.0(8.0) 0.8

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:77.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Stellar Empowerment 15.3 0.0 21.8sec 21.8sec 5.81% 5.58% 0.0(0.0) 15.3

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:5.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Vulnerable (vulnerability) 15.0 80.5 26.8sec 4.2sec 91.86% 95.61% 80.5(80.5) 14.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:91.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vulnerable (vulnerability) 22.6 71.1 17.7sec 4.3sec 86.78% 88.12% 71.1(71.1) 21.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:86.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: bleeding 10.0 0.0 0.0sec 0.0sec 97.23% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add1
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:97.23%
Add1: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Judgment 18.0 5.0 0.0sec 0.0sec 77.72% 93.21% 5.0(5.0) 11.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:77.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Marked for Death 9.9 1.9 0.0sec 0.0sec 40.70% 40.70% 1.9(1.9) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:40.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Add1: Open Wounds 5.8 0.0 0.0sec 0.0sec 34.89% 63.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:34.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add1: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: bleeding 10.0 0.0 0.0sec 0.0sec 97.23% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:97.23%
Add2: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Open Wounds 0.5 0.0 0.0sec -0.1sec 1.48% 4.22% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:1.48%

Trigger Attempt Success

  • trigger_pct:35.99%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add2: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: bleeding 10.0 0.0 0.0sec 0.0sec 92.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:92.06%
Add3: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Open Wounds 0.0 0.0 214.1sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:0.01%

Trigger Attempt Success

  • trigger_pct:0.01%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add3: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: bleeding 10.0 0.0 0.0sec 0.0sec 92.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:92.06%
Add4: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add4: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: bleeding 10.0 0.0 0.0sec 0.0sec 92.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:92.06%
Add5: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add5: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:95.91%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 3242128.78
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 13000
death count pct 129.96
avg death time 400.72
min death time 309.31
max death time 492.94
dmg taken 1299863961.59

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 400.89
Minimum 309.31
Maximum 492.94
Spread ( max - min ) 183.63
Range [ ( max - min ) / 2 * 100% ] 22.90%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 74697.25
Minimum 59029.74
Maximum 84889.87
Spread ( max - min ) 25860.13
Range [ ( max - min ) / 2 * 100% ] 17.31%
Standard Deviation 2563.0541
5th Percentile 70468.70
95th Percentile 78899.44
( 95th Percentile - 5th Percentile ) 8430.74
Mean Distribution
Standard Deviation 25.6318
95.00% Confidence Intervall ( 74647.01 - 74747.49 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4522
0.1 Scale Factor Error with Delta=300 56078
0.05 Scale Factor Error with Delta=300 224315
0.01 Scale Factor Error with Delta=300 5607886
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 74697.25
Minimum 59029.74
Maximum 84889.87
Spread ( max - min ) 25860.13
Range [ ( max - min ) / 2 * 100% ] 17.31%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 29954782.42
Minimum 19451106.19
Maximum 39613027.55
Spread ( max - min ) 20161921.36
Range [ ( max - min ) / 2 * 100% ] 33.65%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 3244143.35
Minimum 3119182.73
Maximum 3426629.22
Spread ( max - min ) 307446.49
Range [ ( max - min ) / 2 * 100% ] 4.74%
Standard Deviation 36314.3191
5th Percentile 3185384.05
95th Percentile 3304725.88
( 95th Percentile - 5th Percentile ) 119341.83
Mean Distribution
Standard Deviation 363.1613
95.00% Confidence Intervall ( 3243431.57 - 3244855.13 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 4
0.1% Error 481
0.1 Scale Factor Error with Delta=300 11257435
0.05 Scale Factor Error with Delta=300 45029743
0.01 Scale Factor Error with Delta=300 1125743583
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2504
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
2 10.21 spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 11.21 spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
4 14.09 melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1

Sample Sequence

1234432432434243243243423424342342343

Sample Sequence Table

time name target resources buffs
0:00.000 auto_attack_tanks Illistan 1329503808.5/1329858192: 100% health vulnerability, vulnerability
0:02.000 spell_dot_Illistan Illistan 1320035983.2/1329858192: 99% health ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability
0:03.004 spell_nuke_Illistan Illistan 1313922231.7/1329858192: 99% health ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability
0:05.009 melee_nuke_Illistan Illistan 1300523941.5/1329858192: 98% health ghostly_strike, demoralizing_shout_debuff, open_wounds, vulnerability, vulnerability, judgment
0:07.012 Waiting 27.000 sec 1284873456.2/1329858192: 97% health ghostly_strike, demoralizing_shout_debuff, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
0:34.012 melee_nuke_Illistan Illistan 1158302046.6/1329858192: 87% health Health Decade (80 - 90), ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability
0:36.016 Waiting 4.000 sec 1150077884.2/1329858192: 86% health Health Decade (80 - 90), ghostly_strike, open_wounds, stellar_empowerment, hunters_mark, vulnerability, vulnerability, judgment
0:40.016 spell_nuke_Illistan Illistan 1134188373.9/1329858192: 85% health Health Decade (80 - 90), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
0:42.021 Waiting 1.000 sec 1126912987.1/1329858192: 85% health Health Decade (80 - 90), ghostly_strike, open_wounds, vulnerability, judgment
0:43.021 spell_dot_Illistan Illistan 1122543671.5/1329858192: 84% health Health Decade (80 - 90), ghostly_strike, open_wounds, vulnerability, judgment
0:44.025 Waiting 19.000 sec 1118581512.6/1329858192: 84% health Health Decade (80 - 90), ghostly_strike, open_wounds, vulnerability, judgment
1:03.025 melee_nuke_Illistan Illistan 1066800537.5/1329858192: 80% health Health Decade (80 - 90), ghostly_strike, open_wounds, stellar_empowerment, vulnerability, vulnerability, judgment
1:05.030 Waiting 12.000 sec 1057535802.1/1329858192: 80% health Health Decade (70 - 80), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
1:17.030 spell_nuke_Illistan Illistan 1018942539.8/1329858192: 77% health Health Decade (70 - 80), ghostly_strike, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
1:19.036 Waiting 5.000 sec 1014062300.2/1329858192: 76% health Health Decade (70 - 80), ghostly_strike, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
1:24.036 spell_dot_Illistan Illistan 1002425508.2/1329858192: 75% health Health Decade (70 - 80), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
1:25.043 Waiting 7.000 sec 1000029183.9/1329858192: 75% health Health Decade (70 - 80), anguish(3), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
1:32.043 melee_nuke_Illistan Illistan 979112752.4/1329858192: 74% health Health Decade (70 - 80), anguish(10), ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
1:34.048 Waiting 20.000 sec 974452739.7/1329858192: 73% health Health Decade (70 - 80), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
1:54.048 spell_nuke_Illistan Illistan 923858439.5/1329858192: 69% health Health Decade (60 - 70), ghostly_strike, open_wounds, vulnerability, judgment
1:56.051 Waiting 5.000 sec 918803641.5/1329858192: 69% health Health Decade (60 - 70), anguish(9), ghostly_strike, vulnerability, vulnerability, judgment
2:01.051 melee_nuke_Illistan Illistan 908056586.0/1329858192: 68% health Health Decade (60 - 70), ghostly_strike, open_wounds, hunters_mark, vulnerability
2:03.057 Waiting 2.000 sec 903754089.2/1329858192: 68% health Health Decade (60 - 70), ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
2:05.057 spell_dot_Illistan Illistan 896668857.2/1329858192: 67% health Health Decade (60 - 70), ghostly_strike, demoralizing_shout_debuff, open_wounds, vulnerability, vulnerability, judgment
2:06.060 Waiting 24.000 sec 892631327.2/1329858192: 67% health Health Decade (60 - 70), ghostly_strike, demoralizing_shout_debuff, open_wounds, vulnerability, vulnerability, judgment
2:30.060 melee_nuke_Illistan Illistan 814776820.2/1329858192: 61% health Health Decade (60 - 70), anguish(10), anguish(7), ghostly_strike, open_wounds, stellar_empowerment, hunters_mark, vulnerability, judgment
2:32.064 spell_nuke_Illistan Illistan 808679525.4/1329858192: 61% health Health Decade (60 - 70), anguish(10), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
2:34.068 Waiting 12.000 sec 802446122.2/1329858192: 60% health Health Decade (60 - 70), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
2:46.068 spell_dot_Illistan Illistan 765134821.6/1329858192: 58% health Health Decade (50 - 60), ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
2:47.072 Waiting 12.000 sec 761758829.7/1329858192: 57% health Health Decade (50 - 60), ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
2:59.072 melee_nuke_Illistan Illistan 725433278.1/1329858192: 55% health Health Decade (50 - 60), anguish(3), ghostly_strike, stellar_empowerment, hunters_mark, vulnerability, vulnerability, judgment
3:01.077 Waiting 8.000 sec 718269763.2/1329858192: 54% health Health Decade (50 - 60), anguish(10), ghostly_strike, hunters_mark, vulnerability, hunters_mark, vulnerability
3:09.077 spell_nuke_Illistan Illistan 688445688.7/1329858192: 52% health Health Decade (50 - 60), ghostly_strike, vulnerability, vulnerability, judgment
3:11.081 Waiting 16.000 sec 682827036.2/1329858192: 51% health Health Decade (50 - 60), ghostly_strike, vulnerability, vulnerability
3:27.081 spell_dot_Illistan Illistan 637492028.4/1329858192: 48% health Health Decade (40 - 50), ghostly_strike, open_wounds, judgment
3:28.086 melee_nuke_Illistan Illistan 635398999.2/1329858192: 48% health Health Decade (40 - 50), ghostly_strike, open_wounds, hunters_mark, vulnerability, judgment
3:30.090 Waiting 16.000 sec 630281212.6/1329858192: 47% health Health Decade (40 - 50), anguish(10), ghostly_strike, open_wounds, vulnerability, judgment
3:46.090 spell_nuke_Illistan Illistan 581056429.9/1329858192: 44% health Health Decade (40 - 50), ghostly_strike, open_wounds, vulnerability, judgment
3:48.094 Waiting 9.000 sec 574263594.0/1329858192: 43% health Health Decade (40 - 50), ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
3:57.094 melee_nuke_Illistan Illistan 554449376.5/1329858192: 42% health Health Decade (40 - 50), ghostly_strike, open_wounds, judgment
3:59.098 Waiting 9.000 sec 549891583.9/1329858192: 41% health Health Decade (40 - 50), ghostly_strike, open_wounds, vulnerability, judgment
4:08.098 spell_dot_Illistan Illistan 520823163.5/1329858192: 39% health Health Decade (30 - 40), ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability, judgment
4:09.101 Waiting 14.000 sec 517441120.4/1329858192: 39% health Health Decade (30 - 40), ghostly_strike, demoralizing_shout_debuff, hunters_mark, vulnerability, vulnerability, judgment
4:23.101 spell_nuke_Illistan Illistan 470599236.0/1329858192: 35% health Health Decade (30 - 40), ghostly_strike, open_wounds, vulnerability, vulnerability
4:25.106 Waiting 1.000 sec 465365005.7/1329858192: 35% health Health Decade (30 - 40), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
4:26.106 melee_nuke_Illistan Illistan 461591477.1/1329858192: 35% health Health Decade (30 - 40), anguish(6), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
4:28.111 Waiting 21.000 sec 455690697.2/1329858192: 34% health Health Decade (30 - 40), anguish(10), ghostly_strike, open_wounds, hunters_mark, vulnerability, judgment
4:49.111 spell_dot_Illistan Illistan 390773254.0/1329858192: 29% health Health Decade (20 - 30), ghostly_strike, open_wounds, hunters_mark, vulnerability, judgment
4:50.117 Waiting 5.000 sec 387605216.2/1329858192: 29% health Health Decade (20 - 30), ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
4:55.117 melee_nuke_Illistan Illistan 376837431.5/1329858192: 28% health Health Decade (20 - 30), ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
4:57.121 Waiting 3.000 sec 370595236.6/1329858192: 28% health Health Decade (20 - 30), anguish(9), ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
5:00.121 spell_nuke_Illistan Illistan 361506477.6/1329858192: 27% health Health Decade (20 - 30), ghostly_strike, open_wounds, stellar_empowerment, vulnerability, vulnerability, judgment
5:02.124 Waiting 22.000 sec 357670651.0/1329858192: 27% health Health Decade (20 - 30), ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
5:24.124 melee_nuke_Illistan Illistan 290004777.0/1329858192: 22% health Health Decade (20 - 30), anguish(9), ghostly_strike, open_wounds, vulnerability, vulnerability
5:26.129 Waiting 4.000 sec 284944555.8/1329858192: 21% health Health Decade (20 - 30), anguish(10), ghostly_strike, open_wounds, vulnerability, vulnerability
5:30.129 spell_dot_Illistan Illistan 274837086.4/1329858192: 21% health Health Decade (20 - 30), ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
5:31.134 Waiting 6.000 sec 272867565.0/1329858192: 21% health Health Decade (20 - 30), ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
5:37.134 spell_nuke_Illistan Illistan 256337287.0/1329858192: 19% health Health Decade (10 - 20), ghostly_strike, open_wounds, vulnerability, vulnerability
5:39.137 Waiting 14.000 sec 250041235.1/1329858192: 19% health Health Decade (10 - 20), ghostly_strike, open_wounds, vulnerability, vulnerability, judgment
5:53.137 melee_nuke_Illistan Illistan 200671092.6/1329858192: 15% health Health Decade (10 - 20), ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
5:55.142 Waiting 16.000 sec 192966175.0/1329858192: 15% health Health Decade (10 - 20), ghostly_strike, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
6:11.142 spell_dot_Illistan Illistan 138786498.4/1329858192: 10% health Health Decade (10 - 20), ghostly_strike, demoralizing_shout_debuff, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
6:12.148 Waiting 2.000 sec 133868339.9/1329858192: 10% health Health Decade (10 - 20), ghostly_strike, demoralizing_shout_debuff, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
6:14.148 spell_nuke_Illistan Illistan 127609601.1/1329858192: 10% health Health Decade (0 - 10), ghostly_strike, demoralizing_shout_debuff, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
6:16.152 Waiting 6.000 sec 117392508.9/1329858192: 9% health Health Decade (0 - 10), ghostly_strike, open_wounds, hunters_mark, vulnerability
6:22.152 melee_nuke_Illistan Illistan 94367884.3/1329858192: 7% health Health Decade (0 - 10), ghostly_strike, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
6:24.156 Waiting 27.000 sec 86998341.3/1329858192: 7% health Health Decade (0 - 10), ghostly_strike, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
6:51.156 spell_nuke_Illistan Illistan 1258164.5/1329858192: 0% health Health Decade (0 - 10), anguish(7), ghostly_strike, vulnerability, vulnerability, judgment

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1037961376 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste INF% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 3474 3474
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary
# gear_ilvl=0.00

Fluffy_Pillow_Add1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add1: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: bleeding 10.0 0.0 0.0sec 0.0sec 97.23% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add1
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:97.23%
Add1: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Judgment 18.0 5.0 0.0sec 0.0sec 77.72% 93.21% 5.0(5.0) 11.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:77.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Marked for Death 9.9 1.9 0.0sec 0.0sec 40.70% 40.70% 1.9(1.9) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:40.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Add1: Open Wounds 5.8 0.0 0.0sec 0.0sec 34.89% 63.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:34.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add1: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource RPS-Gain RPS-Loss
Health 0.00 994899.47
Combat End Resource Mean Min Max
Health 1279998968.63 1018684890.35 1539026568.56

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 9999
Mean 200.00
Minimum 199.31
Maximum 200.00
Spread ( max - min ) 0.69
Range [ ( max - min ) / 2 * 100% ] 0.17%
DPS
Sample Data Add1 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add1 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add1 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 9999
Mean 994899.49
Minimum 917170.80
Maximum 1074212.17
Spread ( max - min ) 157041.36
Range [ ( max - min ) / 2 * 100% ] 7.89%
HPS
Sample Data Add1 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add1 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1038003544 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add1"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add2: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: bleeding 10.0 0.0 0.0sec 0.0sec 97.23% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:97.23%
Add2: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Open Wounds 0.5 0.0 0.0sec -0.1sec 1.48% 4.22% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:1.48%

Trigger Attempt Success

  • trigger_pct:35.99%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add2: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add2
Resource RPS-Gain RPS-Loss
Health 0.00 910675.45
Combat End Resource Mean Min Max
Health 1281156245.08 1020118995.60 1539692343.54

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add2 Fight Length
Count 9999
Mean 200.00
Minimum 199.31
Maximum 200.00
Spread ( max - min ) 0.69
Range [ ( max - min ) / 2 * 100% ] 0.17%
DPS
Sample Data Add2 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add2 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add2 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add2 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add2 Damage Taken Per Second
Count 9999
Mean 910675.48
Minimum 839227.68
Maximum 983400.99
Spread ( max - min ) 144173.31
Range [ ( max - min ) / 2 * 100% ] 7.92%
HPS
Sample Data Add2 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add2 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add2 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add2 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1038003544 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add2"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add3 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add3: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: bleeding 10.0 0.0 0.0sec 0.0sec 92.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:92.06%
Add3: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Open Wounds 0.0 0.0 214.1sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:0.01%

Trigger Attempt Success

  • trigger_pct:0.01%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add3: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add3
Resource RPS-Gain RPS-Loss
Health 0.00 796477.89
Combat End Resource Mean Min Max
Health 1283433484.85 1023052153.66 1542251476.96

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add3 Fight Length
Count 9999
Mean 200.00
Minimum 199.31
Maximum 200.00
Spread ( max - min ) 0.69
Range [ ( max - min ) / 2 * 100% ] 0.17%
DPS
Sample Data Add3 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add3 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add3 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add3 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add3 Damage Taken Per Second
Count 9999
Mean 796477.90
Minimum 732022.28
Maximum 863312.99
Spread ( max - min ) 131290.71
Range [ ( max - min ) / 2 * 100% ] 8.24%
HPS
Sample Data Add3 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add3 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add3 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add3 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1038003544 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add3"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add4 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add4: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: bleeding 10.0 0.0 0.0sec 0.0sec 92.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:92.06%
Add4: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add4: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add4
Resource RPS-Gain RPS-Loss
Health 0.00 786620.63
Combat End Resource Mean Min Max
Health 1283702896.84 1022565325.16 1542816996.26

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add4 Fight Length
Count 9999
Mean 200.00
Minimum 199.31
Maximum 200.00
Spread ( max - min ) 0.69
Range [ ( max - min ) / 2 * 100% ] 0.17%
DPS
Sample Data Add4 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add4 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add4 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add4 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add4 Damage Taken Per Second
Count 9999
Mean 786620.65
Minimum 713811.81
Maximum 859783.30
Spread ( max - min ) 145971.49
Range [ ( max - min ) / 2 * 100% ] 9.28%
HPS
Sample Data Add4 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add4 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add4 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add4 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add4 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add4Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add4 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1038003544 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add4"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add5 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add5: Anguish 5.3 44.6 0.0sec 0.0sec 8.45% 8.45% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.43%
  • anguish_5:0.43%
  • anguish_6:0.41%
  • anguish_7:0.41%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 9.5 80.2 0.0sec 0.0sec 16.24% 16.24% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.08%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.82%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: bleeding 10.0 0.0 0.0sec 0.0sec 92.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:92.06%
Add5: Hunter's Mark 17.1 0.0 0.0sec 0.0sec 30.45% 71.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Hunter's Mark 16.6 0.0 0.0sec 0.0sec 13.27% 75.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Stellar Empowerment 12.9 0.0 0.0sec 0.0sec 9.30% 11.03% 0.0(0.0) 12.2

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add5: Vulnerable (vulnerability) 14.5 18.0 0.0sec 0.0sec 62.33% 66.53% 18.0(18.0) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Vulnerable (vulnerability) 16.9 18.5 0.0sec 0.0sec 58.49% 75.87% 18.5(18.5) 9.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add5
Resource RPS-Gain RPS-Loss
Health 0.00 801542.28
Combat End Resource Mean Min Max
Health 1283556483.95 1022349086.50 1543249074.67

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add5 Fight Length
Count 9999
Mean 200.00
Minimum 199.31
Maximum 200.00
Spread ( max - min ) 0.69
Range [ ( max - min ) / 2 * 100% ] 0.17%
DPS
Sample Data Add5 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add5 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add5 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add5 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add5 Damage Taken Per Second
Count 9999
Mean 801542.30
Minimum 741267.88
Maximum 874531.93
Spread ( max - min ) 133264.05
Range [ ( max - min ) / 2 * 100% ] 8.31%
HPS
Sample Data Add5 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add5 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add5 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add5 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add5 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add5Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add5 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1038003544 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add5"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 400.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.